Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA124666_FCM13.jpg FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of RAW264.7 cells using anti-CCR3 antibody (AAA124666).Overlay histogram showing RAW264.7 cells stained with AAA124666 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCR3 Antibody (AAA124666,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit CCR3 Polyclonal Antibody | anti-CCR3 antibody

Anti-CCR3 Picoband antibody

Average rating 0.0
No ratings yet
Gene Names
CCR3; CKR3; CD193; CMKBR3; CC-CKR-3
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Western Blot, Immunocytochemistry, Immunohistochemistry, Flow Cytometry, Functional Assay
Synonyms
CCR3, Antibody; Anti-CCR3 Picoband antibody; C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; Eosinophil eotaxin receptor; CD193; CMKBR3; anti-CCR3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Form/Format
Lyophilized
Sequence Length
376
Applicable Applications for anti-CCR3 antibody
WB (Western Blot), ICC (Immunocytochemistry), IHC (Immunohistochemistry), FCM/FACS (Flow Cytometry)
Immunogen
A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA).
Subcellular Localization
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In eosinophils as well as trace amounts in neutrophils and monocytes.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of RAW264.7 cells using anti-CCR3 antibody (AAA124666).Overlay histogram showing RAW264.7 cells stained with AAA124666 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCR3 Antibody (AAA124666,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA124666_FCM13.jpg FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of RAW264.7 cells using anti-CCR3 antibody (AAA124666).Overlay histogram showing RAW264.7 cells stained with AAA124666 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCR3 Antibody (AAA124666,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of CCR3 using anti-CCR3 antibody (AAA124666).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysates,Lane 2: human HepG2 whole cell lysates,Lane 3: human MCF-7 whole cell lysates,Lane 4: human U-87MG whole cell lysates,Lane 5: human CCRF-CEM whole cell lysates,Lane 6: rat brain tissue lysates,Lane 7: mouse brain tissue lysates,Lane 8: mouse testis tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CCR3 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CCR3 at approximately 55KD. The expected band size for CCR3 is at 41KD.)

product-image-AAA124666_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of CCR3 using anti-CCR3 antibody (AAA124666).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysates,Lane 2: human HepG2 whole cell lysates,Lane 3: human MCF-7 whole cell lysates,Lane 4: human U-87MG whole cell lysates,Lane 5: human CCRF-CEM whole cell lysates,Lane 6: rat brain tissue lysates,Lane 7: mouse brain tissue lysates,Lane 8: mouse testis tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CCR3 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CCR3 at approximately 55KD. The expected band size for CCR3 is at 41KD.)
Related Product Information for anti-CCR3 antibody
Description: C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.
Protein Function: Receptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,453 Da
NCBI Official Full Name
C-C chemokine receptor type 3 isoform 1
NCBI Official Synonym Full Names
C-C motif chemokine receptor 3
NCBI Official Symbol
CCR3
NCBI Official Synonym Symbols
CKR3; CD193; CMKBR3; CC-CKR-3
NCBI Protein Information
C-C chemokine receptor type 3
UniProt Protein Name
C-C chemokine receptor type 3
UniProt Gene Name
CCR3
UniProt Synonym Gene Names
CMKBR3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CCR3 ccr3 (Catalog #AAA124666) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CCR3 Picoband antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's CCR3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ICC (Immunocytochemistry), IHC (Immunohistochemistry), FCM/FACS (Flow Cytometry). Researchers should empirically determine the suitability of the CCR3 ccr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.