Rabbit CCS Polyclonal Antibody | anti-CCS antibody

Anti-CCS Antibody

Cat. Num. AAA46716

• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: CCS, Antibody; Anti-CCS Antibody; CCS; SOD 4; SOD4; O14618; Copper chaperone for superoxide dismutase; anti-CCS antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 274

• Applicable Applications for anti-CCS antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174-209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(CCS was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- CCS Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of CCS expression in rat brain extract (lane 1), rat spleen extract (lane 2), mouse brain extract (lane 3), mouse spleen extract (lane 4) and 293T whole cell lysates (lane 5). CCS at 34KD was detected using rabbit anti- CCS Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

Related Product Information for anti-CCS antibody

Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase(CCS) detection.
Background: Copper chaperone for superoxide dismutase is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.

References

1. Bartnikas, T. B., Waggoner, D. J., Casareno, R. L. B., Gaedigk, R., White, R. A., Gitlin, J. D. Chromosomal localization of CCS, the copper chaperone for Cu/Zn superoxide dismutase. Mammalian Genome 11: 409-411, 2000.
2. Casareno, R. L. B., Waggoner, D., Gitlin, J. D. The copper chaperone CCS directly interacts with copper/zinc superoxide dismutase.J. Biol. Chem. 273: 23625-23628, 1998.
3. Huppke, P., Brendel, C., Korenke, G. C., Marquardt, I., Donsante, A., Yi, L., Hicks, J. D., Steinbach, P. J., Wilson, C., Elpeleg, O., Moller, L. B., Christodoulou, J., Kaler, S. G., Gartner, J. Molecular and biochemical characterization of a unique mutation in CCS, the human copper chaperone to superoxide dismutase. Hum. Mutat. 33: 1207-1215, 2012.

NCBI and Uniprot Product Information

• NCBI GI #: 4826665
• NCBI GeneID: 9973
• NCBI Accession #: NP_005116.1
• NCBI GenBank Nucleotide #: NM_005125.1
• UniProt Accession #: O14618; Q2M366; Q8NEV0
• NCBI Official Full Name: copper chaperone for superoxide dismutase
• NCBI Official Synonym Full Names: copper chaperone for superoxide dismutase
• NCBI Official Symbol: CCS
• NCBI Protein Information: copper chaperone for superoxide dismutase
• UniProt Protein Name: Copper chaperone for superoxide dismutase
• UniProt Gene Name: CCS