WB (Western Blot)
(WB Suggested Anti-CCT6B Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Rabbit CCT6B Polyclonal Antibody | anti-CCT6B antibody
CCT6B antibody - N-terminal region
Gene Names
CCT6B; Cctz2; CCTZ-2; TSA303; CCT-zeta-2; TCP-1-zeta-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCT6B, Antibody; CCT6B antibody - N-terminal region; anti-CCT6B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL
Sequence Length
530
Applicable Applications for anti-CCT6B antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CCT6B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-CCT6B Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
WB (Western Blot)
(WB Suggested Anti-CCT6B Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
WB (Western Blot)
(WB Suggested Anti-CCT4 Antibody Titration: 1 ug/mlLane 1: 10ug of HEK293CCT6B is supported by BioGPS gene expression data to be expressed in HEK293T)
WB (Western Blot)
(WB Suggested Anti-CCT4 Antibody Titration: 1 ug/mlLane 1: 10ug of HEK293CCT6B is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-CCT6B antibody
This is a rabbit polyclonal antibody against CCT6B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Target Description: CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Product Categories/Family for anti-CCT6B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
T-complex protein 1 subunit zeta-2 isoform 1
NCBI Official Synonym Full Names
chaperonin containing TCP1 subunit 6B
NCBI Official Symbol
CCT6B
NCBI Official Synonym Symbols
Cctz2; CCTZ-2; TSA303; CCT-zeta-2; TCP-1-zeta-2
NCBI Protein Information
T-complex protein 1 subunit zeta-2
UniProt Protein Name
T-complex protein 1 subunit zeta-2
UniProt Gene Name
CCT6B
UniProt Synonym Gene Names
TCP-1-zeta-2
UniProt Entry Name
TCPW_HUMAN
Similar Products
Product Notes
The CCT6B cct6b (Catalog #AAA200317) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCT6B antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCT6B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CCT6B cct6b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VARTSLQTKV HAELADVLTE VVVDSVLAVR RPGYPIDLFM VEIMEMKHKL. It is sometimes possible for the material contained within the vial of "CCT6B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.