Rabbit anti-Mouse, Human CD1D Polyclonal Antibody | anti-CD1D antibody

Anti-CD1D Antibody IHC-plus

Cat. Num. AAA162163

• Gene Names: CD1D; R3; CD1A; R3G1
• Reactivity: Mouse, Human
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity purified
• Synonyms: CD1D, Antibody; Anti-CD1D Antibody IHC-plus; Rabbit Polyclonal (IgG) to Human CD1D; Human CD1D; CD1D antigen; d polypeptide; R3; R3G1; CD1d antigen; CD1d molecule; Thymocyte antigen CD1D; anti-CD1D antibody

• Host: Rabbit
• Reactivity: Mouse, Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Human CD1D
• Purity/Purification: Affinity purified
• Form/Format: PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
• Concentration: 1.87 mg/ml (varies by lot)
• Sequence: EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSG
• Sequence Length: 335

• Applicable Applications for anti-CD1D antibody: WB (Western Blot), IHC (Immunohistochemistry)
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-190 of human CD1D (NP_001757.1).
• Immunogen Type: Recombinant protein
• Immunogen Species: CD1D antibody was raised against Human
• Disclaimer: Due to the highly specific nature of antibodies and antigens, we cannot predict or be held responsible with respect to how this antibody will behave in your systems. Researchers using this antibody should conduct optimization studies to achieve the most optimal result possible for their intended application.
• Recommended Immunohistochemistry Protocol: The following protocol is a recommendation only, and AAA Biotech makes no guarantee of the results:; ; Tissue Preparation: ; Formalin fixation and embedding in paraffin wax. ; ; Tissue Sectioning: ; Make 4-um sections and place on pre-cleaned and charged microscope slides. Heat in a tissue-dryingoven for 45 minutes at 60°C. ; ; Deparaffinization: ; Wash dry slides in 3 changes of xylene - 5 minutes each @ RT; ; Rehydration: ; Wash slides in 3 changes of 100% alcohol - 3 minutes each @ RT; Wash slides in 2 changes of 95% alcohol - 3 minutes each @ RT; Wash slides in 1 change of 80% alcohol - 3 minutes @ RT; Rinse slides in gentle running distilled water - 5 minutes @ RT; ; Antigen retrieval: ; Steam slides in 0.01 M sodium citrate buffer, pH 6.0 at 99-100°C - 20 minutes; Remove from heat and let stand at room temperature in buffer - 20 minutes; Rinse in 1X TBS with Tween (TBST) -1 minute @ RT; ; Immunostaining: ; (Do not allow tissues to dry at any time during the staining procedure) ; Apply a universal protein block - 20 minutes @ RT; Drain protein block from slides, apply diluted primary antibody - 45 minutes @ RT; Rinse slides in 1 X TBST - 1 minute @ RT; Apply a biotinylated secondary antibody appropriate for the primary antibody - 30 minutes @ RT; Rinse slides in 1X TBST -1 minute @ RT; Apply alkaline phosphatase streptavidin - 30 minutes @ RT; Rinse slides in 1X TBST -1 minute @ RT; Apply alkaline phosphatase chromogen substrate - 30 minutes @ RT; Wash slides in distilled water - 1 minute @ RT; ; Dehydrate: ; (This method should only be used if the chromogen substrate is alcohol insoluble (e.g. Vector Red, DAB) ; Wash slides in 2 changes of 80% alcohol - 1 minute each @ RT; Wash slides in 2 changes of 95% alcohol - 1 minute each @ RT; Wash slides in 3 changes of 100% alcohol - 1 minute each @ RT; Wash slides in 3 changes of xylene - 1 minute each @ RT; Apply coverslip
• Preparation and Storage: Store at -20°C. Avoid freeze-thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CD1D antibody.)

IHC (Immunohistochemistry)

(Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE))

NCBI and Uniprot Product Information

• NCBI GI #: 4502649
• NCBI GeneID: 912
• NCBI Accession #: NP_001757.1
• NCBI GenBank Nucleotide #: NM_001766.3
• UniProt Accession #: P15813; Q5W0J3; Q9UMM3; Q9Y5M4; D3DVD5
• NCBI Official Full Name: antigen-presenting glycoprotein CD1d isoform 1
• NCBI Official Synonym Full Names: CD1d molecule
• NCBI Official Symbol: CD1D
• NCBI Official Synonym Symbols: R3; CD1A; R3G1
• NCBI Protein Information: antigen-presenting glycoprotein CD1d
• UniProt Protein Name: Antigen-presenting glycoprotein CD1d
• UniProt Gene Name: CD1D
• UniProt Entry Name: CD1D_HUMAN