IHC (Immunohiostchemistry)
(Anti- CD36 Picoband antibody, AAA46317, IHC(P)IHC(P): Rat Spleen Tissue)
CD36 Polyclonal Antibody | anti-CD36 antibody
Anti-CD36 Antibody
Gene Names
CD36; FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
CD36, Antibody; Anti-CD36 Antibody; Platelet glycoprotein 4; Adipocyte membrane protein; CD36; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 antigen; CD36 molecule (thrombospondin receptor); CD36 molecule; CD36_HUMAN; CHDS7; Cluster determinant 36; Collagen receptor, platelet; FAT; Fatty acid translocase; Fatty acid transport protein; Glycoprotein IIIb; GP IIIb; GP3B; GP4; GPIIIB; GPIV; Leukocyte differentiation antigen CD36; MGC108510; MGC91634; PAS 4 protein; PAS IV; PAS-4; PASIV; Platelet collagen receptor; Platelet glycoprotein IV; scarb3; Scavenger receptor class B member 3; Thrombospondin receptor; anti-CD36 antibody
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
472
Applicable Applications for anti-CD36 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohiostchemistry)
(Anti- CD36 Picoband antibody, AAA46317, IHC(P)IHC(P): Rat Spleen Tissue)
IHC (Immunohiostchemistry)
(Anti- CD36 Picoband antibody, AAA46317, IHC(P)IHC(P): Rat Spleen Tissue)
WB (Western Blot)
(Anti- CD36 Picoband antibody, AAA46317, Western blottingAll lanes: Anti CD36 (AAA46317) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Cardiac Muscle Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 5: SMMC Whole Cell Lysate at 40ugPredicted bind size: 53KDObserved bind size: 88KD)
WB (Western Blot)
(Anti- CD36 Picoband antibody, AAA46317, Western blottingAll lanes: Anti CD36 (AAA46317) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Cardiac Muscle Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 5: SMMC Whole Cell Lysate at 40ugPredicted bind size: 53KDObserved bind size: 88KD)
Related Product Information for anti-CD36 antibody
Description: Rabbit IgG polyclonal antibody for Platelet glycoprotein 4(CD36) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Background: CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, (FAT)/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is anintegral membrane protein found on the surface of many cell types in vertebrate animals. CD36 is a member of the class B scavenger receptor family of cell surface proteins. It is mapped to 7q21.11. And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. In addition, CD36 function in long-chain fatty acid uptake and signaling can be irreversibly inhibited by sulfo-N-succinimidyl oleate (SSO), which binds lysine 164 within a hydrophobic pocked shared by several CD36 ligands, e.g. fatty acid and oxLDL.
Background: CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, (FAT)/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is anintegral membrane protein found on the surface of many cell types in vertebrate animals. CD36 is a member of the class B scavenger receptor family of cell surface proteins. It is mapped to 7q21.11. And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. In addition, CD36 function in long-chain fatty acid uptake and signaling can be irreversibly inhibited by sulfo-N-succinimidyl oleate (SSO), which binds lysine 164 within a hydrophobic pocked shared by several CD36 ligands, e.g. fatty acid and oxLDL.
References
1. Tandon NN, Kralisz U, Jamieson GA (5 May 1989). "Identification of glycoprotein IV (CD36) as a primary receptor for platelet-collagen adhesion". J. Biol. Chem. 264 (13): 7576-83. PMID 2468670. 2. Jump up ^ Silverstein RL, Baird M, Lo SK, Yesner LM (15 August 1992). "Sense and antisense cDNA transfection of CD36 (glycoprotein IV) in melanoma cells. Role of CD36 as a thrombospondin receptor". J. Biol. Chem. 267 (23): 16607-12. PMID 1379600. 3. Kuda O, Pietka TA, Demianova Z, Kudova E, Cvacka J, Kopecky J, Abumrad NA (May 2013). "Sulfo-N-succinimidyl Oleate (SSO) Inhibits Fatty Acid Uptake and Signaling for Intracellular Calcium via Binding CD36 Lysine 164: SSO ALSO INHIBITS OXIDIZED LOW DENSITY LIPOPROTEIN UPTAKE BY MACROPHAGES.". J. Biol. Chem. 288 (22): 15547-55. doi:10.1074/jbc.M113.473298.PMID 23603908.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,090 Da
NCBI Official Full Name
platelet glycoprotein 4 isoform 1
NCBI Official Synonym Full Names
CD36 molecule
NCBI Official Symbol
CD36
NCBI Official Synonym Symbols
FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10
NCBI Protein Information
platelet glycoprotein 4
UniProt Protein Name
Platelet glycoprotein 4
UniProt Gene Name
CD36
UniProt Synonym Gene Names
GP3B; GP4; FAT; GPIIIB; GPIV
UniProt Entry Name
CD36_HUMAN
Similar Products
Product Notes
The CD36 cd36 (Catalog #AAA46317) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-CD36 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD36 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CD36 cd36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.