WB (Western Blot)
(WB Suggested Anti-CD3E Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Rabbit anti-Human CD3E Polyclonal Antibody | anti-CD3E antibody
CD3E antibody - middle region
Gene Names
CD3E; T3E; TCRE; IMD18
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD3E, Antibody; CD3E antibody - middle region; anti-CD3E antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP
Sequence Length
207
Applicable Applications for anti-CD3E antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CD3E
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-CD3E Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Human brain)
WB (Western Blot)
(WB Suggested Anti-CD3E Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Human brain)
IHC (Immunohistochemistry)
(Rabbit Anti-CD3E AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-CD3E AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CD3E antibody
This is a rabbit polyclonal antibody against CD3E. It was validated on Western Blot
Target Description: The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Target Description: The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Product Categories/Family for anti-CD3E antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
T-cell surface glycoprotein CD3 epsilon chain
NCBI Official Synonym Full Names
CD3e molecule
NCBI Official Symbol
CD3E
NCBI Official Synonym Symbols
T3E; TCRE; IMD18
NCBI Protein Information
T-cell surface glycoprotein CD3 epsilon chain
UniProt Protein Name
T-cell surface glycoprotein CD3 epsilon chain
UniProt Gene Name
CD3E
UniProt Synonym Gene Names
T3E
UniProt Entry Name
CD3E_HUMAN
Similar Products
Product Notes
The CD3E cd3e (Catalog #AAA200899) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD3E antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD3E can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CD3E cd3e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QYPGSEILWQ HNDKNIGGDE DDKNIGSDED HLSLKEFSEL EQSGYYVCYP. It is sometimes possible for the material contained within the vial of "CD3E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.