Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46420_IHC13.jpg IHC (Immunohiostchemistry) (Anti- CD45 Picoband antibody, AAA46420, IHC(P)IHC(P): Human Tonsil Tissue)

anti-Human CD45 Polyclonal Antibody | anti-CD45 antibody

Anti-CD45 Antibody

Average rating 0.0
No ratings yet
Gene Names
PTPRC; LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
CD45, Antibody; Anti-CD45 Antibody; Receptor-type tyrosine-protein phosphatase C; B220; CD 45; CD45; CD45 antigen; CD45R; GP180; L CA; L-CA; LCA; Leukocyte common antigen; loc; Ly-5; LY5; Lyt-4; OTTHUMP00000033813; OTTHUMP00000033816; OTTHUMP00000033817; OTTHUMP00000038574; Protein tyrosine phosphatase receptor type C; Protein tyrosine phosphatase receptor type c polypeptide; protein tyrosine phosphatase, receptor type, C; PTPRC; PTPRC_HUMAN; SCID due to PTPRC deficiency; T200; T200 glycoprotein; T200 leukocyte common antigen antibody; anti-CD45 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1306
Applicable Applications for anti-CD45 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CD45(1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- CD45 Picoband antibody, AAA46420, IHC(P)IHC(P): Human Tonsil Tissue)

product-image-AAA46420_IHC13.jpg IHC (Immunohiostchemistry) (Anti- CD45 Picoband antibody, AAA46420, IHC(P)IHC(P): Human Tonsil Tissue)

WB (Western Blot)

(Anti- CD45 Picoband antibody, AAA46420, Western blottingAll lanes: Anti CD45 (AAA46420) at 0.5ug/mlLane 1: JURKAT Whole Cell Lysate at 40ugLane 2: HL-60 Whole Cell Lysate at 40ugLane 3: K562 Whole Cell Lysate at 40ugPredicted bind size: 220KDObserved bind size: 220KD)

product-image-AAA46420_WB15.jpg WB (Western Blot) (Anti- CD45 Picoband antibody, AAA46420, Western blottingAll lanes: Anti CD45 (AAA46420) at 0.5ug/mlLane 1: JURKAT Whole Cell Lysate at 40ugLane 2: HL-60 Whole Cell Lysate at 40ugLane 3: K562 Whole Cell Lysate at 40ugPredicted bind size: 220KDObserved bind size: 220KD)
Related Product Information for anti-CD45 antibody
Description: Rabbit IgG polyclonal antibody for Receptor-type tyrosine-protein phosphatase C(PTPRC) detection. Tested with WB, IHC-P in Human.

Background: CD45 (Cluster of Differentiation 45), also known as PTPRC, LCA or CD45R, is an enzyme that, in humans, is encoded by the PTPRC gene. It is a member of the protein tyrosine phosphatase (PTP) family. CD45 is a major high molecular mass leukocyte cell surface molecule which is also an integral membrane protein tyrosine phosphatase. The cytogenetic location of CD45 is 1q31.3-q32.1. This gene is especially a prototype for transmembrane protein-tyrosine phosphatase (PTP). Targeted disruption of the CD45 gene leads to enhanced cytokine and interferon receptor-mediated activation of JAKs and STAT proteins. In vitro, CD45 directly dephosphorylates and binds to JAKs. Functionally, CD45 negatively regulates interleukin-3-mediated cellular proliferation, erythropoietin-dependent hematopoiesis, and antiviral responses in vitro and in vivo. In addition, CD45 has been best studied in T cells, where it determines T cell receptor signaling thresholds. CD45 is moved into or out of the immunological synapse (IS) membrane microdomain depending on the relative influence of interaction with the extracellular galectin lattice or the intracellular actin cytoskeleton. Galectin interaction can be finetuned by varying usage of the heavily Oglycosylated spliced regions and sialylation of Nlinked carbohydrates.
References
1. Anderson, J.N. et al. (2004) FASEB J. 18:8. 2. Akao, Y., Utsumi, K. R., Naito, K., Ueda, R., Takahashi, T., Yamada, K. Chromosomal assignments of genes coding for human leukocyte common antigen, T-200, and lymphocyte function-associated antigen 1, LFA-1 beta subunit. Somat. Cell Molec. Genet. 13: 273-278, 1987. 3. Falahti, R. and D. Leitenberg (2008) J. Immunol. 181:6082.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
130,898 Da
NCBI Official Full Name
receptor-type tyrosine-protein phosphatase C isoform 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase, receptor type C
NCBI Official Symbol
PTPRC
NCBI Official Synonym Symbols
LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180
NCBI Protein Information
receptor-type tyrosine-protein phosphatase C
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase C
UniProt Gene Name
PTPRC
UniProt Synonym Gene Names
CD45; L-CA
UniProt Entry Name
PTPRC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD45 ptprc (Catalog #AAA46420) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-CD45 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD45 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CD45 ptprc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD45, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.