Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281699_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using CD52 antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Mouse CD52 Polyclonal Antibody | anti-CD52 antibody

CD52 Rabbit pAb

Gene Names
CD52; CDW52; EDDM5
Reactivity
Human, Mouse
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
CD52, Antibody; CD52 Rabbit pAb; CD52; CDW52; EDDM5; anti-CD52 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Applicable Applications for anti-CD52 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-61 of human CD52 (NP_001794.2).
Positive Samples
Mouse bone marrow
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using CD52 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281699_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using CD52 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using CD52 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281699_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using CD52 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of Mouse bone marrow, using CD52 Rabbit pAb at 1:300 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

product-image-AAA281699_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Mouse bone marrow, using CD52 Rabbit pAb at 1:300 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Product Categories/Family for anti-CD52 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
6,614 Da
NCBI Official Full Name
CAMPATH-1 antigen
NCBI Official Synonym Full Names
CD52 molecule
NCBI Official Symbol
CD52
NCBI Official Synonym Symbols
CDW52; EDDM5
NCBI Protein Information
CAMPATH-1 antigen
UniProt Protein Name
CAMPATH-1 antigen
UniProt Gene Name
CD52
UniProt Synonym Gene Names
CDW52; HE5; He5

Similar Products

Product Notes

The CD52 cd52 (Catalog #AAA281699) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD52 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD52 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CD52 cd52 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKRFLFLLLT ISLLVMVQIQ TGLSGQNDTS QTSSPSASSN ISGGIFLFFV ANAIIHLFCF S. It is sometimes possible for the material contained within the vial of "CD52, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.