WB (Western Blot)
(Host: RabbitTarget: CD68Positive control (+): Mouse Liver (M-LI)Negative control (-): Mouse Heart (M-HE)Antibody concentration: 1ug/ml)
Rabbit CD68 Polyclonal Antibody | anti-CD68 antibody
CD68 antibody - middle region
Gene Names
CD68; GP110; LAMP4; SCARD1
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD68, Antibody; CD68 antibody - middle region; anti-CD68 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Pig
Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: EAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYL
Sequence Length
327
Applicable Applications for anti-CD68 antibody
WB (Western Blot)
Homology
Guinea Pig: 79%; Human: 100%; Mouse: 79%; Pig: 93%; Rat: 93%
Protein Size (# AA)
327 amino acids
Protein Interactions
ADRB2; RALGDS;
Blocking Peptide
For anti-CD68 (MBS3215841) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget: CD68Positive control (+): Mouse Liver (M-LI)Negative control (-): Mouse Heart (M-HE)Antibody concentration: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget: CD68Positive control (+): Mouse Liver (M-LI)Negative control (-): Mouse Heart (M-HE)Antibody concentration: 1ug/ml)
WB (Western Blot)
(WB Suggested Anti-CD68 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
WB (Western Blot)
(WB Suggested Anti-CD68 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-CD68 antibody
Target Description: This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages.
Product Categories/Family for anti-CD68 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35kDa
NCBI Official Full Name
macrosialin isoform B
NCBI Official Synonym Full Names
CD68 molecule
NCBI Official Symbol
CD68
NCBI Official Synonym Symbols
GP110; LAMP4; SCARD1
NCBI Protein Information
macrosialin
UniProt Protein Name
Macrosialin
UniProt Gene Name
CD68
UniProt Entry Name
CD68_HUMAN
Similar Products
Product Notes
The CD68 cd68 (Catalog #AAA201149) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD68 antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's CD68 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CD68 cd68 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAWGISVLNP NKTKVQGSCE GAHPHLLLSF PYGHLSFGFM QDLQQKVVYL. It is sometimes possible for the material contained within the vial of "CD68, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.