Rabbit anti-Human, Mouse CD80 Polyclonal Antibody | anti-CD80 antibody
CD80 Polyclonal Antibody
Gene Names
CD80; B7; BB1; B7-1; B7.1; LAB7; CD28LG; CD28LG1
Reactivity
Human, Mouse
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
CD80, Antibody; CD80 Polyclonal Antibody; CD80; B7; B7-1; B7.1; BB1; CD28LG; CD28LG1; LAB7; CD80 molecule; anti-CD80 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.82 mg/ml (varies by lot)
Sequence Length
288
Applicable Applications for anti-CD80 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD80 (NP_005182.1).
Immunogen Sequence
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS
Positive Samples
A-549, U-87MG
Cellular Location
Membrane, Single-Pass Type I Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Related Product Information for anti-CD80 antibody
The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 18kDa; 29kDa; 33kDa
Observed: 60kDa
Observed: 60kDa
NCBI Official Full Name
T-lymphocyte activation antigen CD80
NCBI Official Synonym Full Names
CD80 molecule
NCBI Official Symbol
CD80
NCBI Official Synonym Symbols
B7; BB1; B7-1; B7.1; LAB7; CD28LG; CD28LG1
NCBI Protein Information
T-lymphocyte activation antigen CD80
UniProt Protein Name
T-lymphocyte activation antigen CD80
UniProt Gene Name
CD80
UniProt Synonym Gene Names
CD28LG; CD28LG1; LAB7; B7
Similar Products
Product Notes
The CD80 cd80 (Catalog #AAA281455) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD80 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD80 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the CD80 cd80 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD80, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
