Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201684_WB13.jpg WB (Western Blot) (WB Suggested Anti-CDC34 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Thymus)

Rabbit CDC34 Polyclonal Antibody | anti-CDC34 antibody

CDC34 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
CDC34; UBC3; UBCH3; UBE2R1; E2-CDC34
Reactivity
Cow, Dog, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CDC34, Antibody; CDC34 antibody - middle region; anti-CDC34 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEE
Sequence Length
236
Applicable Applications for anti-CDC34 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDC34
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CDC34 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Thymus)

product-image-AAA201684_WB13.jpg WB (Western Blot) (WB Suggested Anti-CDC34 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Thymus)

IHC (Immunohistochemistry)

(Rabbit Anti-CDC34 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic near intercalated discsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201684_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-CDC34 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic near intercalated discsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CDC34 antibody
This is a rabbit polyclonal antibody against CDC34. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CDC34 catalyzes the covalent attachment of ubiquitin to other proteins. CDC34 may be involved in degradation of katenin.The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-CDC34 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
997
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 R1
NCBI Official Synonym Full Names
cell division cycle 34
NCBI Official Symbol
CDC34
NCBI Official Synonym Symbols
UBC3; UBCH3; UBE2R1; E2-CDC34
NCBI Protein Information
ubiquitin-conjugating enzyme E2 R1
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 R1
UniProt Gene Name
CDC34
UniProt Synonym Gene Names
UBCH3; UBE2R1
UniProt Entry Name
UB2R1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CDC34 cdc34 (Catalog #AAA201684) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC34 antibody - middle region reacts with Cow, Dog, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDC34 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CDC34 cdc34 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLAEYCVKTK APAPDEGSDL FYDDYYEDGE VEEEADSCFG DDEDDSGTEE. It is sometimes possible for the material contained within the vial of "CDC34, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.