Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201673_WB13.jpg WB (Western Blot) (WB Suggested Anti-CDK6 Antibody Titration: 0.625ug/mlPositive Control: Jurkat cell lysateCDK6 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit CDK6 Polyclonal Antibody | anti-CDK6 antibody

CDK6 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CDK6; MCPH12; PLSTIRE
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit
Applications
Western Blot
Purity
Protein A purified
Synonyms
CDK6, Antibody; CDK6 antibody - C-terminal region; anti-CDK6 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Sequence Length
326
Applicable Applications for anti-CDK6 antibody
WB (Western Blot)
Homology
Cow: 84%; Dog: 84%; Horse: 84%; Human: 100%; Mouse: 76%; Pig: 84%; Rabbit: 84%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CDK6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CDK6 Antibody Titration: 0.625ug/mlPositive Control: Jurkat cell lysateCDK6 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA201673_WB13.jpg WB (Western Blot) (WB Suggested Anti-CDK6 Antibody Titration: 0.625ug/mlPositive Control: Jurkat cell lysateCDK6 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Rabbit Anti-CDK6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: Cytoplasm, NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201673_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-CDK6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: Cytoplasm, NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CDK6 antibody
This is a rabbit polyclonal antibody against CDK6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CDK6 is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb.The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
cyclin-dependent kinase 6
NCBI Official Synonym Full Names
cyclin dependent kinase 6
NCBI Official Symbol
CDK6
NCBI Official Synonym Symbols
MCPH12; PLSTIRE
NCBI Protein Information
cyclin-dependent kinase 6
UniProt Protein Name
Cyclin-dependent kinase 6
UniProt Gene Name
CDK6
UniProt Synonym Gene Names
CDKN6
UniProt Entry Name
CDK6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CDK6 cdk6 (Catalog #AAA201673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK6 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CDK6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CDK6 cdk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLKCLTFNPA KRISAYSALS HPYFQDLERC KENLDSHLPP SQNTSELNTA. It is sometimes possible for the material contained within the vial of "CDK6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.