<
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug CDKN1A/p21CIP1 antibody. Western blot was performed from the immunoprecipitate using CDKN1A/p21CIP1 antibody at a dilution of 1:500.)
Rabbit anti-Human CDKN1A/p21CIP1 Polyclonal Antibody | anti-CDKN1A/p21CIP1 antibody
CDKN1A/p21CIP1 Rabbit pAb
Gene Names
HINT1; HINT; NMAN; PKCI-1; PRKCNH1
Reactivity
Human
Applications
Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
CDKN1A/p21CIP1, Antibody; CDKN1A/p21CIP1 Rabbit pAb; CDKN1A; CAP20; CDKN1; CIP1; MDA-6; P21; SDI1; WAF1; p21CIP1; cyclin-dependent kinase inhibitor 1; anti-CDKN1A/p21CIP1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Applicable Applications for anti-CDKN1A/p21CIP1 antibody
IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-164 of human CDKN1A/p21CIP1 (NP_000380.1).
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug CDKN1A/p21CIP1 antibody. Western blot was performed from the immunoprecipitate using CDKN1A/p21CIP1 antibody at a dilution of 1:500.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug CDKN1A/p21CIP1 antibody. Western blot was performed from the immunoprecipitate using CDKN1A/p21CIP1 antibody at a dilution of 1:500.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug CDKN1A/p21CIP1 antibody. Western blot was performed from the immunoprecipitate using CDKN1A/p21CIP1 antibody at a dilution of 1:500.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug CDKN1A/p21CIP1 antibody. Western blot was performed from the immunoprecipitate using CDKN1A/p21CIP1 antibody at a dilution of 1:500.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded human liver using CDKN1A/p21CIP1 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded human liver using CDKN1A/p21CIP1 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
WB (Western Blot)
(Western blot analysis of extracts of MCF7 cells, using CDKN1A/P21cip1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of extracts of MCF7 cells, using CDKN1A/P21cip1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)
Related Product Information for anti-CDKN1A/p21CIP1 antibody
This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen, a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of cyclin-dependent kinase2, and may be instrumental in the execution of apoptosis following caspase activation. Mice that lack this gene have the ability to regenerate damaged or missing tissue. Multiple alternatively spliced variants have been found for this gene.
Product Categories/Family for anti-CDKN1A/p21CIP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,802 Da
NCBI Official Full Name
histidine triad nucleotide-binding protein 1
NCBI Official Synonym Full Names
histidine triad nucleotide binding protein 1
NCBI Official Symbol
HINT1
NCBI Official Synonym Symbols
HINT; NMAN; PKCI-1; PRKCNH1
NCBI Protein Information
histidine triad nucleotide-binding protein 1; protein kinase C inhibitor 1; adenosine 5'-monophosphoramidase; protein kinase C-interacting protein 1
UniProt Protein Name
Histidine triad nucleotide-binding protein 1
UniProt Gene Name
HINT1
UniProt Synonym Gene Names
HINT; PKCI1; PRKCNH1; PKCI-1
UniProt Entry Name
HINT1_HUMAN
Similar Products
Product Notes
The CDKN1A/p21CIP1 hint1 (Catalog #AAA282286) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDKN1A/p21CIP1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKN1A/p21CIP1 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CDKN1A/p21CIP1 hint1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADEIAKAQV ARPGGDTIFG KIIRKEIPAK IIFEDDRCLA FHDISPQAPT HFLVIPKKHI SQISVAEDDD ESLLGHLMIV GKKCAADLGL NKGYRMVVNE GSDGGQSVYH VHLHVLGGRQ MHWPPG. It is sometimes possible for the material contained within the vial of "CDKN1A/p21CIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.