Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA28422_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human breast cancer using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Mouse anti-Human CEACAM5 Polyclonal Antibody | anti-CEACAM5 antibody

CEACAM5 Mouse mAb

Gene Names
SNRK2.3; SNRK2-3; SRK2I; SUCROSE NONFERMENTING 1 (SNF1)-RELATED PROTEIN KINASE 2-3; sucrose nonfermenting 1(SNF1)-related protein kinase 2.3
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunoprecipitation
Purity
Affinity purification
Synonyms
CEACAM5, Antibody; CEACAM5 Mouse mAb; CEACAM5; CD66e; CEA; anti-CEACAM5 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
DVWSCGVTLYVMLVGAYPFEDPEEPRDYRKTIQRILSVKYSIPDDIRISPECCHLISRIFVADPATRISIPEIKTHSWFLKNLPADLMNESNTGSQFQEPE
Applicable Applications for anti-CEACAM5 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IP: 1:50-1:200
Positive Samples
MCF7
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 35-685 of human CEACAM5.
Cellular Location
Cell membrane, GPI-anchor, Lipid-anchor
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human breast cancer using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28422_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human breast cancer using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded Human urothelial carcinoma using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28422_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded Human urothelial carcinoma using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human hepatocellular carcinoma using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28422_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human hepatocellular carcinoma using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28422_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human appendix using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28422_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human appendix using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human tonsil (negative control sample) using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28422_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human tonsil (negative control sample) using CEACAM5 antibody at dilution of 100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of MCF7 cells, using CEACAM5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

product-image-AAA28422_WB.jpg WB (Western Blot) (Western blot analysis of extracts of MCF7 cells, using CEACAM5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)
Related Product Information for anti-CEACAM5 antibody
This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded protein may regulate differentiation, apoptosis, and cell polarity. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,085 Da
NCBI Official Full Name
sucrose nonfermenting 1(SNF1)-related protein kinase 2.3
NCBI Official Symbol
SNRK2.3
NCBI Official Synonym Symbols
SNRK2-3; SRK2I; SUCROSE NONFERMENTING 1 (SNF1)-RELATED PROTEIN KINASE 2-3; sucrose nonfermenting 1(SNF1)-related protein kinase 2.3
NCBI Protein Information
sucrose nonfermenting 1(SNF1)-related protein kinase 2.3
UniProt Protein Name
Serine/threonine-protein kinase SRK2I
UniProt Gene Name
SRK2I
UniProt Synonym Gene Names
41K; OSKL2; SNRK2.3; SnRK2.3

Similar Products

Product Notes

The CEACAM5 srk2i (Catalog #AAA28422) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CEACAM5 Mouse mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEACAM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP). WB: 1:500-1:2000 IHC: 1:50-1:200 IP: 1:50-1:200. Researchers should empirically determine the suitability of the CEACAM5 srk2i for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DVWSCGVTLY VMLVGAYPFE DPEEPRDYRK TIQRILSVKY SIPDDIRISP ECCHLISRIF VADPATRISI PEIKTHSWFL KNLPADLMNE SNTGSQFQEP E. It is sometimes possible for the material contained within the vial of "CEACAM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.