Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23473_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: CELF2Sample Type: JurkatAntibody Dilution: 1.0ug/mlCELF2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit anti-Human CELF2 Polyclonal Antibody | anti-CELF2 antibody

CELF2 Antibody - N-terminal region

Gene Names
CELF2; ETR3; ETR-3; NAPOR; CELF-2; CUGBP2; BRUNOL3; CUG-BP2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CELF2, Antibody; CELF2 Antibody - N-terminal region; anti-CELF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCN
Sequence Length
508
Applicable Applications for anti-CELF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CELF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: CELF2Sample Type: JurkatAntibody Dilution: 1.0ug/mlCELF2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA23473_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: CELF2Sample Type: JurkatAntibody Dilution: 1.0ug/mlCELF2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: CELF2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23473_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: CELF2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CELF2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23473_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: CELF2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CELF2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23473_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: CELF2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CELF2Sample Type: 721_BAntibody Dilution: 1.0ug/mlCELF2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA23473_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: CELF2Sample Type: 721_BAntibody Dilution: 1.0ug/mlCELF2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: CELF2Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

product-image-AAA23473_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: CELF2Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CELF2 antibody
This is a rabbit polyclonal antibody against CUGBP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-CELF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
CUGBP Elav-like family member 2 isoform 3
NCBI Official Synonym Full Names
CUGBP Elav-like family member 2
NCBI Official Symbol
CELF2
NCBI Official Synonym Symbols
ETR3; ETR-3; NAPOR; CELF-2; CUGBP2; BRUNOL3; CUG-BP2
NCBI Protein Information
CUGBP Elav-like family member 2
UniProt Protein Name
CUGBP Elav-like family member 2
UniProt Gene Name
CELF2
UniProt Synonym Gene Names
BRUNOL3; CUGBP2; ETR3; NAPOR; CELF-2; CUG-BP2; ETR-3; hNAPOR
UniProt Entry Name
CELF2_HUMAN

Similar Products

Product Notes

The CELF2 celf2 (Catalog #AAA23473) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CELF2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CELF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CELF2 celf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AALEAQNALH NIKTLPGMHH PIQMKPADSE KSNAVEDRKL FIGMVSKKCN. It is sometimes possible for the material contained within the vial of "CELF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.