WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using CHCHD4 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Rabbit anti-Human, Mouse CHCHD4 Polyclonal Antibody | anti-CHCHD4 antibody
CHCHD4 Polyclonal Antibody
Gene Names
CHCHD4; MIA40; TIMM40
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CHCHD4, Antibody; CHCHD4 Polyclonal Antibody; MIA40; TIMM40; anti-CHCHD4 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
Sequence Length
142
Applicable Applications for anti-CHCHD4 antibody
WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human CHCHD4 (NP_001091972.1)
Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW
15kDa/17kDa
Observed MW
20kDa
Preparation and Storage
Store at -20°C. Avoid freeze / thaw cycles.
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using CHCHD4 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using CHCHD4 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Product Categories/Family for anti-CHCHD4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
mitochondrial intermembrane space import and assembly protein 40 isoform 1
NCBI Official Synonym Full Names
coiled-coil-helix-coiled-coil-helix domain containing 4
NCBI Official Symbol
CHCHD4
NCBI Official Synonym Symbols
MIA40; TIMM40
NCBI Protein Information
mitochondrial intermembrane space import and assembly protein 40
UniProt Protein Name
Mitochondrial intermembrane space import and assembly protein 40
UniProt Gene Name
CHCHD4
UniProt Synonym Gene Names
MIA40
Similar Products
Product Notes
The CHCHD4 chchd4 (Catalog #AAA280984) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHCHD4 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CHCHD4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CHCHD4 chchd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSYCRQEGKD RIIFVTKEDH ETPSSAELVA DDPNDPYEEH GLILPNGNIN WNCPCLGGMA SGPCGEQFKS AFSCFHYSTE EIKGSDCVDQ FRAMQECMQK YPDLYPQEDE DEEEEREKKP AEQAEETAPI EATATKEEEG SS. It is sometimes possible for the material contained within the vial of "CHCHD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.