Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46376_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Chk2 Picoband antibody, AAA46376, IHC(P)IHC(P): Human Lung Cancer Tissue)

Chk2 Polyclonal Antibody | anti-Chk2 antibody

Anti-Chk2 Antibody

Average rating 0.0
No ratings yet
Gene Names
CHEK2; CDS1; CHK2; LFS2; RAD53; hCds1; HuCds1; PP1425
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Chk2, Antibody; Anti-Chk2 Antibody; Serine/threonine-protein kinase Chk2; bA444G7; CDS 1; CDS1; Checkpoint kinase 2; Checkpoint like protein CHK2; Chek 2; Chek2; Chk 2; CHK2 checkpoint homolog (S. pombe); CHK2 checkpoint homolog; CHK2_HUMAN; HuCds 1; HuCds1; LFS 2; LFS2; PP1425; RAD 53; RAD53; Rad53 homolog; Serine/threonine protein kinase Chk2; Serine/ threonine-protein kinase Chk2 antibody; checkpoint kinase 2; anti-Chk2 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
586
Applicable Applications for anti-Chk2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- Chk2 Picoband antibody, AAA46376, IHC(P)IHC(P): Human Lung Cancer Tissue)

product-image-AAA46376_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Chk2 Picoband antibody, AAA46376, IHC(P)IHC(P): Human Lung Cancer Tissue)

WB (Western Blot)

(Anti- Chk2 Picoband antibody, AAA46376, Western blottingAll lanes: Anti Chk2 (AAA46376) at 0.5ug/mlLane 1: Rat Spleen Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: SW620 Whole Cell Lysate at 40ugPredicted bind size: 65KDObserved bind size: 65KD)

product-image-AAA46376_WB15.jpg WB (Western Blot) (Anti- Chk2 Picoband antibody, AAA46376, Western blottingAll lanes: Anti Chk2 (AAA46376) at 0.5ug/mlLane 1: Rat Spleen Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: SW620 Whole Cell Lysate at 40ugPredicted bind size: 65KDObserved bind size: 65KD)
Related Product Information for anti-Chk2 antibody
Description: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that proceed to enforce checkpoint control in irradiated cells. Moreover, CHK2 is a tumor suppressor gene conferring predisposition to sarcoma, breast cancer, and brain tumors, and that their observations provided a link between the central role of p53 inactivation in human cancer and the well-defined G2 checkpoint in yeast. There is a wide expression of small amounts of CHK2 mRNA with larger amounts in human testis, spleen, colon, and peripheral blood leukocytes.
References
1. Ahn, J.-Y.; Li, X.; Davis, H. L.; Canman, C. E. : Phosphorylation of threonine 68 promotes oligomerization and autophosphorylation of the Chk2 protein kinase via the forkhead-associated domain. J. Biol. Chem. 277: 19389-19395, 2002. 2. Bell, D. W.; Varley, J. M.; Szydlo, T. E.; Kang, D. H.; Wahrer, D. C. R.; Shannon, K. E.; Lubratovich, M.; Verselis, S. J.; Isselbacher, K. J.; Fraumeni, J. F.; Birch, J. M.; Li, F. P.; Garber, J. E.; Haber, D. A. : Heterozygous germ line hCHK2 mutations in Li-Fraumeni syndrome. Science 286: 2528-2531, 1999. 3. Brown, A. L.; Lee, C.-H.; Schwarz, J. K.; Mitiku, N.; Piwnica-Worms, H.; Chung, J. H. : A human Cds1-related kinase that functions downstream of ATM protein in the cellular response to DNA damage. Proc. Nat. Acad. Sci. 96: 3745-3750, 1999. 4. Lee, J.-S.; Collins, K. M.; Brown, A. L.; Lee, C.-H.; Chung, J. H. : hCds1-mediated phosphorylation of BRCA1 regulates the DNA damage response. Nature 404: 201-204, 2000.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,157 Da
NCBI Official Full Name
serine/threonine-protein kinase Chk2 isoform c
NCBI Official Synonym Full Names
checkpoint kinase 2
NCBI Official Symbol
CHEK2
NCBI Official Synonym Symbols
CDS1; CHK2; LFS2; RAD53; hCds1; HuCds1; PP1425
NCBI Protein Information
serine/threonine-protein kinase Chk2
UniProt Protein Name
Serine/threonine-protein kinase Chk2
UniProt Gene Name
CHEK2
UniProt Synonym Gene Names
CDS1; CHK2; RAD53; Hucds1; hCds1
UniProt Entry Name
CHK2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Chk2 chek2 (Catalog #AAA46376) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Chk2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Chk2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Chk2 chek2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Chk2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.