Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA124677_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of U-87 cells using anti-CHRNA3 antibody (AAA124677).Overlay histogram showing U-87 cells stained with AAA124677 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA3 Antibody (AAA124677,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit CHRNA3 Polyclonal Antibody | anti-CHRNA3 antibody

Anti-CHRNA3 Picoband Antibody

Gene Names
CHRNA3; LNCR2; PAOD2; NACHRA3
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Western Blot
Synonyms
CHRNA3, Antibody; Anti-CHRNA3 Picoband Antibody; Neuronal acetylcholine receptor subunit alpha-3; CHRNA3; NACHRA3; anti-CHRNA3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Form/Format
Lyophilized
Sequence Length
489
Applicable Applications for anti-CHRNA3 antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD).
Subcellular Localization
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of U-87 cells using anti-CHRNA3 antibody (AAA124677).Overlay histogram showing U-87 cells stained with AAA124677 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA3 Antibody (AAA124677,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA124677_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of U-87 cells using anti-CHRNA3 antibody (AAA124677).Overlay histogram showing U-87 cells stained with AAA124677 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA3 Antibody (AAA124677,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of U251 cells using anti-CHRNA3 antibody (AAA124677).Overlay histogram showing U251 cells stained with AAA124677 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA3 Antibody (AAA124677,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA124677_FCM13.jpg FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of U251 cells using anti-CHRNA3 antibody (AAA124677).Overlay histogram showing U251 cells stained with AAA124677 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA3 Antibody (AAA124677,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of CHRNA3 using anti-CHRNA3 antibody (AAA124677).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human MDA-MB-453 whole cell lysates,Lane 3: human Jurkat whole cell lysates,Lane 4: human HepG2 whole cell lysates,Lane 5: human SK-OV-3 whole cell lysates,Lane 6: human PANC-1 whole cell lysates,Lane 7: mouse thymus tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CHRNA3 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CHRNA3 at approximately 60KD. The expected band size for CHRNA3 is at 57KD.)

product-image-AAA124677_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of CHRNA3 using anti-CHRNA3 antibody (AAA124677).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human MDA-MB-453 whole cell lysates,Lane 3: human Jurkat whole cell lysates,Lane 4: human HepG2 whole cell lysates,Lane 5: human SK-OV-3 whole cell lysates,Lane 6: human PANC-1 whole cell lysates,Lane 7: mouse thymus tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CHRNA3 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CHRNA3 at approximately 60KD. The expected band size for CHRNA3 is at 57KD.)
Related Product Information for anti-CHRNA3 antibody
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,637 Da
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-3 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 3 subunit
NCBI Official Symbol
CHRNA3
NCBI Official Synonym Symbols
LNCR2; PAOD2; NACHRA3
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-3
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-3
UniProt Gene Name
CHRNA3
UniProt Synonym Gene Names
NACHRA3

Similar Products

Product Notes

The CHRNA3 chrna3 (Catalog #AAA124677) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CHRNA3 Picoband Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNA3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CHRNA3 chrna3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHRNA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.