Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283279_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Mouse kidney tissue using CHUK Rabbit pAb (AAA283279) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

Rabbit anti-Rat CHUK Polyclonal Antibody | anti-CHUK antibody

CHUK Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Rat
Applications
ELISA, Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
CHUK, Antibody; CHUK Rabbit pAb; Ikka; Ikbka; anti-CHUK antibody
Ordering
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
SRSLSDCVNYIVQDSKIQLPVTQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFRKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYSEVGVIGYLEDQIMSLHTEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPTDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACRD
Applicable Applications for anti-CHUK antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence)
Cross Reactivity
Human, Mouse
Immunogen
Recombinant Protein corresponding to a sequence within amino acids 400-660 of rat CHUK(NP_001101058.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of paraffin-embedded Mouse kidney tissue using CHUK Rabbit pAb (AAA283279) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA283279_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Mouse kidney tissue using CHUK Rabbit pAb (AAA283279) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using CHUK Rabbit pAb (AAA283279) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283279_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using CHUK Rabbit pAb (AAA283279) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
Related Product Information for anti-CHUK antibody
Contributes to IkappaB kinase activity. Involved in several processes, including Rho protein signal transduction; response to cholecystokinin; and response to lipopolysaccharide. Located in cytosol and intracellular membrane-bounded organelle. Part of IkappaB kinase complex. Used to study muscular atrophy. Biomarker of colitis. Human ortholog(s) of this gene implicated in fetal encasement syndrome and prostate cancer. Orthologous to human CHUK (component of inhibitor of nuclear factor kappa B kinase complex).
Product Categories/Family for anti-CHUK antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 78kDa

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CHUK (Catalog #AAA283279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHUK Rabbit pAb reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHUK can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the CHUK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SRSLSDCVNY IVQDSKIQLP VTQLRKVWAE AVHYVSGLKE DYSRLFQGQR AAMLSLLRYN ANLTKMKNTL ISASQQLKAK LEFFRKSIQL DLERYSEQMT YGISSEKMLK AWKEMEEKAI HYSEVGVIGY LEDQIMSLHT EIMELQKSPY GRRQGDLMES LEQRAIDLYK QLKHRPTDHS YSDSTEMVKI IVHTVQSQDR VLKELFGHLS KLLGCKQKII DLLPKVEVAL SNIKEADNTV MFMQGKRQKE IWHLLKIACR D. It is sometimes possible for the material contained within the vial of "CHUK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.