IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using Cleaved Caspase-1 p20 Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
Rabbit anti-Human, Mouse Cleaved Caspase-1 p20 Polyclonal Antibody | anti-p20 antibody
Cleaved Caspase-1 p20 Rabbit pAb
Gene Names
BRAF; NS7; BRAF1; RAFB1; B-RAF1
Reactivity
Human, Mouse
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry
Purity
Affinity purification
Synonyms
Cleaved Caspase-1 p20, Antibody; Cleaved Caspase-1 p20 Rabbit pAb; CASP1; ICE; IL1BC; P45; caspase-1; Caspase 1; anti-p20 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
DEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDD
Applicable Applications for anti-p20 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Cleaved Caspase-1 p20 (NP_150634.1).
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using Cleaved Caspase-1 p20 Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using Cleaved Caspase-1 p20 Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded human liver cancer using Cleaved Caspase-1 p20 Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded human liver cancer using Cleaved Caspase-1 p20 Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
Related Product Information for anti-p20 antibody
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms.
Product Categories/Family for anti-p20 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,437 Da
NCBI Official Full Name
serine/threonine-protein kinase B-raf
NCBI Official Synonym Full Names
v-raf murine sarcoma viral oncogene homolog B1
NCBI Official Symbol
BRAF
NCBI Official Synonym Symbols
NS7; BRAF1; RAFB1; B-RAF1
NCBI Protein Information
serine/threonine-protein kinase B-raf; 94 kDa B-raf protein; proto-oncogene B-Raf; murine sarcoma viral (v-raf) oncogene homolog B1; B-Raf proto-oncogene serine/threonine-protein kinase (p94)
UniProt Protein Name
Serine/threonine-protein kinase B-raf
UniProt Gene Name
BRAF
UniProt Synonym Gene Names
BRAF1; RAFB1
UniProt Entry Name
BRAF_HUMAN
Similar Products
Product Notes
The p20 braf (Catalog #AAA282269) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cleaved Caspase-1 p20 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Cleaved Caspase-1 p20 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the p20 braf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DEDHRNQFGQ RDRSSSAPNV HINTIEPVNI DDLIRDQGFR GDGGSTTGLS ATPPASLPGS LTNVKALQKS PGPQRERKSS SSSEDRNRMK TLGRRDSSDD. It is sometimes possible for the material contained within the vial of "Cleaved Caspase-1 p20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.