Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199455_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CLEC2DSample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CLEC2D Polyclonal Antibody | anti-CLEC2D antibody

CLEC2D Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CLEC2D; CLAX; LLT1; OCIL
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLEC2D, Antibody; CLEC2D Antibody - C-terminal region; anti-CLEC2D antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GQPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRR
Sequence Length
194
Applicable Applications for anti-CLEC2D antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLEC2D
Protein Size (# AA)
194 amino acids
Protein Interactions
KLRB1;
Blocking Peptide
For anti-CLEC2D (MBS3207394) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: CLEC2DSample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA199455_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CLEC2DSample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CLEC2D antibody
This is a rabbit polyclonal antibody against CLEC2D. It was validated on Western Blot

Target Description: This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene.
Product Categories/Family for anti-CLEC2D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
C-type lectin domain family 2 member D isoform 1
NCBI Official Synonym Full Names
C-type lectin domain family 2 member D
NCBI Official Symbol
CLEC2D
NCBI Official Synonym Symbols
CLAX; LLT1; OCIL
NCBI Protein Information
C-type lectin domain family 2 member D
UniProt Protein Name
C-type lectin domain family 2 member D
UniProt Gene Name
CLEC2D
UniProt Synonym Gene Names
CLAX; LLT1; OCIL; LLT-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CLEC2D clec2d (Catalog #AAA199455) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLEC2D Antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC2D can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CLEC2D clec2d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQPWKWINGT EWTRQLVMKE DGANLYVAKV SQVPRMNPRP VMVSYPGSRR. It is sometimes possible for the material contained within the vial of "CLEC2D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.