Rabbit anti-Human, Pig CLEC4M Polyclonal Antibody | anti-CLEC4M antibody
CLEC4M antibody - N-terminal region
Gene Names
CLEC4M; CD299; LSIGN; CD209L; L-SIGN; DCSIGNR; HP10347; DC-SIGN2; DC-SIGNR
Reactivity
Human, Pig
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
CLEC4M, Antibody; CLEC4M antibody - N-terminal region; anti-CLEC4M antibody
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV
Sequence Length
399
Applicable Applications for anti-CLEC4M antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CLEC4M
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CLEC4M antibody
This is a rabbit polyclonal antibody against CLEC4M. It was validated on Western Blot and immunohistochemistry
Target Description: CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells. This gene is mapped to 19p13.3, in a cluster with the CD209 and CD23/FCER2 genes. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.
Target Description: CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells. This gene is mapped to 19p13.3, in a cluster with the CD209 and CD23/FCER2 genes. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.
Product Categories/Family for anti-CLEC4M antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
C-type lectin domain family 4 member M isoform 1
NCBI Official Synonym Full Names
C-type lectin domain family 4 member M
NCBI Official Symbol
CLEC4M
NCBI Official Synonym Symbols
CD299; LSIGN; CD209L; L-SIGN; DCSIGNR; HP10347; DC-SIGN2; DC-SIGNR
NCBI Protein Information
C-type lectin domain family 4 member M
UniProt Protein Name
C-type lectin domain family 4 member M
UniProt Gene Name
CLEC4M
UniProt Synonym Gene Names
CD209L; CD209L1; CD299; DC-SIGNR; DC-SIGN2; L-SIGN
UniProt Entry Name
CLC4M_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CLEC4M clec4m (Catalog #AAA199112) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLEC4M antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC4M can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CLEC4M clec4m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVLQLLSFML LAGVLVAILV QVSKVPSSLS QEQSEQDAIY QNLTQLKAAV. It is sometimes possible for the material contained within the vial of "CLEC4M, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
