Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA28292_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry-CLNS1A Polyclonal Antibody)

Rabbit CLNS1A Polyclonal Antibody | anti-CLNS1A antibody

CLNS1A Polyclonal Antibody

Gene Names
CLNS1A; CLCI; ICln; CLNS1B
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
CLNS1A, Antibody; CLNS1A Polyclonal Antibody; CLNS1A; CLCI; CLNS1B; ICln; methylosome subunit pICln; anti-CLNS1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.51 mg/ml (varies by lot)
Sequence Length
237
Applicable Applications for anti-CLNS1A antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CLNS1A (NP_001284.1).
Immunogen Sequence
MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Positive Samples
HT-29, 293T, DU145, Jurkat, HeLa, Mouse Brain
Cellular Location
Cytoplasm, Nucleus, Cytoskeleton, Cytosol
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

product-image-AAA28292_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry-CLNS1A Polyclonal Antibody)

IHC (Immunohistchemistry)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

product-image-AAA28292_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry-CLNS1A Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

product-image-AAA28292_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry-CLNS1A Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

product-image-AAA28292_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry-CLNS1A Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

product-image-AAA28292_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry-CLNS1A Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

product-image-AAA28292_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry-CLNS1A Polyclonal Antibody)

WB (Western Blot)

(Western blot-CLNS1A Polyclonal Antibody)

product-image-AAA28292_WB.jpg WB (Western Blot) (Western blot-CLNS1A Polyclonal Antibody)
Related Product Information for anti-CLNS1A antibody
This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 26kDa
Observed: 38kDa
NCBI Official Full Name
methylosome subunit pICln isoform a
NCBI Official Synonym Full Names
chloride nucleotide-sensitive channel 1A
NCBI Official Symbol
CLNS1A
NCBI Official Synonym Symbols
CLCI; ICln; CLNS1B
NCBI Protein Information
methylosome subunit pICln
UniProt Protein Name
Methylosome subunit pICln
UniProt Gene Name
CLNS1A
UniProt Synonym Gene Names
CLCI; ICLN; I(Cln); ClCI
UniProt Entry Name
ICLN_HUMAN

Similar Products

Product Notes

The CLNS1A clns1a (Catalog #AAA28292) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLNS1A Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLNS1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the CLNS1A clns1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLNS1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.