Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199426_WB11.jpg WB (Western Blot) (WB Suggested Anti-COMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)

Rabbit COMT Polyclonal Antibody | anti-COMT antibody

COMT antibody - middle region

Gene Names
COMT; HEL-S-98n
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COMT, Antibody; COMT antibody - middle region; anti-COMT antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH
Sequence Length
271
Applicable Applications for anti-COMT antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 79%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human COMT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-COMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)

product-image-AAA199426_WB11.jpg WB (Western Blot) (WB Suggested Anti-COMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)

WB (Western Blot)

(Lanes:1. 100 ug Human lung microsome lysatePrimary Antibody Dilution:1: 1000Secondary Antibody:Secondary Antibody Dilution:1: 10000Gene Name:COMTSubmitted by:Jing Peng, Fox Chase Cancer Center)

product-image-AAA199426_WB13.jpg WB (Western Blot) (Lanes:1. 100 ug Human lung microsome lysatePrimary Antibody Dilution:1: 1000Secondary Antibody:Secondary Antibody Dilution:1: 10000Gene Name:COMTSubmitted by:Jing Peng, Fox Chase Cancer Center)

WB (Western Blot)

(COMT antibody - middle region validated by WB using rat liver, mouse lung, human brain at 1:1000.)

product-image-AAA199426_WB15.jpg WB (Western Blot) (COMT antibody - middle region validated by WB using rat liver, mouse lung, human brain at 1:1000.)
Related Product Information for anti-COMT antibody
This is a rabbit polyclonal antibody against COMT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathwa

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
catechol O-methyltransferase isoform MB-COMT
NCBI Official Synonym Full Names
catechol-O-methyltransferase
NCBI Official Symbol
COMT
NCBI Official Synonym Symbols
HEL-S-98n
NCBI Protein Information
catechol O-methyltransferase
UniProt Protein Name
Catechol O-methyltransferase
UniProt Gene Name
COMT
UniProt Entry Name
COMT_HUMAN

Similar Products

Product Notes

The COMT comt (Catalog #AAA199426) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COMT antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COMT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the COMT comt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDCAAITQRM VDFAGVKDKV TLVVGASQDI IPQLKKKYDV DTLDMVFLDH. It is sometimes possible for the material contained within the vial of "COMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.