Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282198_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of 293T-N and 293T cells using SARS-CoV-2 Nucleoprotein antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Mouse anti-SARS-CoV-2 COVID 19 Nucleocapsid (NP) Coronavirus Polyclonal Antibody | anti-COVID-19 antibody

SARS-CoV-2 N Protein Mouse mAb

Average rating 0.0
No ratings yet
Gene Names
YWHAG; 14-3-3GAMMA
Reactivity
SARS-CoV-2
Applications
Immunocytochemistry, Immunofluorescence, Western Blot, ELISA
Purity
Affinity purification
Synonyms
COVID 19 Nucleocapsid (NP) Coronavirus, Antibody; SARS-CoV-2 N Protein Mouse mAb; 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; Nucleocapsid; Nucleoprotein (NP); Nucleoprotein; NP; anti-COVID-19 antibody
Ordering
Host
Mouse
Reactivity
SARS-CoV-2
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
Applicable Applications for anti-COVID-19 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot), ELISA
Positive Samples
293T
Immunogen
Recombinant fusion protein of SARS-CoV-2 Nucleoprotein.
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of 293T-N and 293T cells using SARS-CoV-2 Nucleoprotein antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282198_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of 293T-N and 293T cells using SARS-CoV-2 Nucleoprotein antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Application Data

(Immobilized Recombinant 2019-nCoV Nucleocapsid Protein at 1 ug/mL (100 uL/well) can bind SARS-CoV-2 Nucleoprotein Rabbit mAb with a linear range of 3.12-200ng/mL.)

product-image-AAA282198_AD13.jpg Application Data (Immobilized Recombinant 2019-nCoV Nucleocapsid Protein at 1 ug/mL (100 uL/well) can bind SARS-CoV-2 Nucleoprotein Rabbit mAb with a linear range of 3.12-200ng/mL.)

WB (Western Blot)

(Western blot analysis of extracts of normal 293T cells 293T transfected with N Protein, using SARS-COV-2 N Protein antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA282198_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of normal 293T cells 293T transfected with N Protein, using SARS-COV-2 N Protein antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Related Product Information for anti-COVID-19 antibody
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. May modulate transforming growth factor-beta signaling by binding host SMAD3.
Product Categories/Family for anti-COVID-19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,303 Da
NCBI Official Full Name
14-3-3 protein gamma
NCBI Official Synonym Full Names
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
NCBI Official Symbol
YWHAG
NCBI Official Synonym Symbols
14-3-3GAMMA
NCBI Protein Information
14-3-3 protein gamma; KCIP-1; 14-3-3 gamma; protein kinase C inhibitor protein 1
UniProt Protein Name
14-3-3 protein gamma
UniProt Gene Name
YWHAG
UniProt Synonym Gene Names
KCIP-1
UniProt Entry Name
1433G_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The COVID-19 ywhag (Catalog #AAA282198) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SARS-CoV-2 N Protein Mouse mAb reacts with SARS-CoV-2 and may cross-react with other species as described in the data sheet. AAA Biotech's COVID 19 Nucleocapsid (NP) Coronavirus can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the COVID-19 ywhag for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VLSLLDNYLI KNCSETQYES KVFYLKMKGD YYRYLAEVAT GEKRATVVES SEKAYSEAHE ISKEHMQPTH PIRLGLALNY SVFYYEIQNA PEQACHLAKT A. It is sometimes possible for the material contained within the vial of "COVID 19 Nucleocapsid (NP) Coronavirus, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.