Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281157_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffinembedded mouse spleen using CRACR2A antibody at dilution of 1:150 (40x lens).)

Rabbit anti-Human, Mouse CRACR2A Polyclonal Antibody | anti-CRACR2A antibody

CRACR2A Polyclonal Antibody

Gene Names
CRACR2A; EFCAB4B
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
CRACR2A, Antibody; CRACR2A Polyclonal Antibody; EFCAB4B; anti-CRACR2A antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDF
Sequence Length
731
Applicable Applications for anti-CRACR2A antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CRACR2A (NP_001138430.1).
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Positive Samples
HeLa, Mouse liver, Rat liver
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffinembedded mouse spleen using CRACR2A antibody at dilution of 1:150 (40x lens).)

product-image-AAA281157_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffinembedded mouse spleen using CRACR2A antibody at dilution of 1:150 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CRACR2A antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA281157_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CRACR2A antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Product Categories/Family for anti-CRACR2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 45kDa; 83kDa
Observed: 45kDa
NCBI Official Full Name
EF-hand calcium-binding domain-containing protein 4B isoform a
NCBI Official Synonym Full Names
calcium release activated channel regulator 2A
NCBI Official Symbol
CRACR2A
NCBI Official Synonym Symbols
EFCAB4B
NCBI Protein Information
EF-hand calcium-binding domain-containing protein 4B
UniProt Protein Name
EF-hand calcium-binding domain-containing protein 4B
UniProt Gene Name
CRACR2A
UniProt Synonym Gene Names
EFCAB4B; CRAC channel regulator 2A

Similar Products

Product Notes

The CRACR2A cracr2a (Catalog #AAA281157) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRACR2A Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CRACR2A can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CRACR2A cracr2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAPDGRVVS RPQRLGQGSG QGPKGSGACL HPLDSLEQKE TQEQTSGQLV MLRKAQEFFQ TCDAEGKGFI ARKDMQRLHK ELPLSLEELE DVFDALDADG NGYLTPQEFT TGFSHFFFSQ NNPSQEDAGE QVAQRHEEKV YLSRGDEDLG DMGEDEEAQF RMLMDRLGAQ KVLEDESDVK QLWLQLKKEE PHLLSNFEDF. It is sometimes possible for the material contained within the vial of "CRACR2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.