Rabbit CREB3L1 Polyclonal Antibody | anti-CREB3L1 antibody
CREB3L1 antibody - N-terminal region
Gene Names
CREB3L1; OI16; OASIS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CREB3L1, Antibody; CREB3L1 antibody - N-terminal region; anti-CREB3L1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG
Sequence Length
519
Applicable Applications for anti-CREB3L1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CREB3L1 antibody
This is a rabbit polyclonal antibody against CREB3L1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The CREB3L1 gene encodes a protein with a transmembrane domain that is a transcriptional activator of the CREB/ATF family.
Target Description: The CREB3L1 gene encodes a protein with a transmembrane domain that is a transcriptional activator of the CREB/ATF family.
Product Categories/Family for anti-CREB3L1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57kDa
NCBI Official Full Name
cyclic AMP-responsive element-binding protein 3-like protein 1
NCBI Official Synonym Full Names
cAMP responsive element binding protein 3 like 1
NCBI Official Symbol
CREB3L1
NCBI Official Synonym Symbols
OI16; OASIS
NCBI Protein Information
cyclic AMP-responsive element-binding protein 3-like protein 1
Similar Products
Product Notes
The CREB3L1 (Catalog #AAA198053) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CREB3L1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CREB3L1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CREB3L1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTENMEDFSN DLFSSFFDDP VLDEKSPLLD MELDSPTPGI QAEHSYSLSG. It is sometimes possible for the material contained within the vial of "CREB3L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
