Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201513_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CRKSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human CRK Polyclonal Antibody | anti-CRK antibody

CRK Antibody - middle region

Gene Names
CRK; p38; CRKII
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CRK, Antibody; CRK Antibody - middle region; anti-CRK antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPN
Sequence Length
304
Applicable Applications for anti-CRK antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CRK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: CRKSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201513_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CRKSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CRKSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201513_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CRKSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CRK antibody
This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described.
Product Categories/Family for anti-CRK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
adapter molecule crk isoform b
NCBI Official Synonym Full Names
CRK proto-oncogene, adaptor protein
NCBI Official Symbol
CRK
NCBI Official Synonym Symbols
p38; CRKII
NCBI Protein Information
adapter molecule crk
UniProt Protein Name
Adapter molecule crk
UniProt Gene Name
CRK
UniProt Entry Name
CRK_HUMAN

Similar Products

Product Notes

The CRK crk (Catalog #AAA201513) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRK Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRK can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CRK crk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVPYVEKYRP ASASVSALIG GNQEGSHPQP LGGPEPGPYA QPSVNTPLPN. It is sometimes possible for the material contained within the vial of "CRK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.