Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197646_WB11.jpg WB (Western Blot) (WB Suggested Anti-CRSP9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateMED7 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit CRSP9 Polyclonal Antibody | anti-MED7 antibody

CRSP9 antibody - N-terminal region

Gene Names
MED7; ARC34; CRSP9; CRSP33
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CRSP9, Antibody; CRSP9 antibody - N-terminal region; anti-MED7 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQ
Sequence Length
233
Applicable Applications for anti-MED7 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CRSP9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateMED7 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA197646_WB11.jpg WB (Western Blot) (WB Suggested Anti-CRSP9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateMED7 is supported by BioGPS gene expression data to be expressed in HEK293T)

IHC (Immunohiostchemistry)

(Rabbit Anti-CRSP9 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Nuclear (strong) in hepatocytes, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA197646_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-CRSP9 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Nuclear (strong) in hepatocytes, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

IHC (Immunohistochemistry)

(CRSP9 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasm and nuclear membrane in Human Pineal TissuePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA197646_IHC15.jpg IHC (Immunohistochemistry) (CRSP9 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasm and nuclear membrane in Human Pineal TissuePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-MED7 antibody
This is a rabbit polyclonal antibody against CRSP9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CRSP9 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. CRSP9 is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated p

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 7
NCBI Official Synonym Full Names
mediator complex subunit 7
NCBI Official Symbol
MED7
NCBI Official Synonym Symbols
ARC34; CRSP9; CRSP33
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 7
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 7
UniProt Gene Name
MED7
UniProt Synonym Gene Names
ARC34; CRSP9; hMED7; ARC34; CRSP complex subunit 9
UniProt Entry Name
MED7_HUMAN

Similar Products

Product Notes

The MED7 med7 (Catalog #AAA197646) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRSP9 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CRSP9 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MED7 med7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGEPQQVSAL PPPPMQYIKE YTDENIQEGL APKPPPPIKD SYMMFGNQFQ. It is sometimes possible for the material contained within the vial of "CRSP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.