Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA126399_FCM10.png FCM/FACS (Flow Cytometry) (Figure 4. Flow Cytometry analysis of THP-1 cells using anti-CSNK2A2 antibody (AAA126399).Overlay histogram showing THP-1 cells stained with AAA126399 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CSNK2A2 Antibody (AAA126399, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit CSNK2A2 Polyclonal Antibody | anti-CSNK2A2 antibody

Anti-CSNK2A2 Antibody Picoband

Gene Names
CSNK2A2; CK2A2; CSNK2A1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
CSNK2A2, Antibody; Anti-CSNK2A2 Antibody Picoband; anti-CSNK2A2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-CSNK2A2 antibody
WB (Western Blot), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry)
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence of human CSNK2A2 (EHPYFYPVVKEQSQPCADNAVLSSGLTAAR).
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 4. Flow Cytometry analysis of THP-1 cells using anti-CSNK2A2 antibody (AAA126399).Overlay histogram showing THP-1 cells stained with AAA126399 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CSNK2A2 Antibody (AAA126399, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126399_FCM10.png FCM/FACS (Flow Cytometry) (Figure 4. Flow Cytometry analysis of THP-1 cells using anti-CSNK2A2 antibody (AAA126399).Overlay histogram showing THP-1 cells stained with AAA126399 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CSNK2A2 Antibody (AAA126399, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of Caco-2 cells using anti-CSNK2A2 antibody (AAA126399).Overlay histogram showing Caco-2 cells stained with AAA126399 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CSNK2A2 Antibody (AAA126399, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126399_FCM11.png FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of Caco-2 cells using anti-CSNK2A2 antibody (AAA126399).Overlay histogram showing Caco-2 cells stained with AAA126399 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CSNK2A2 Antibody (AAA126399, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 2. IF analysis of CSNK2A2 using anti-CSNK2A2 antibody (AAA126399).CSNK2A2 was detected in an immunocytochemical section of Caco-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL rabbit anti-CSNK2A2 Antibody (AAA126399) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA126399_IF13.jpg IF (Immunofluorescence) (Figure 2. IF analysis of CSNK2A2 using anti-CSNK2A2 antibody (AAA126399).CSNK2A2 was detected in an immunocytochemical section of Caco-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL rabbit anti-CSNK2A2 Antibody (AAA126399) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

WB (Western Blot)

(Figure 1. Western blot analysis of CSNK2A2 using anti-CSNK2A2 antibody (AAA126399).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human 293T whole cell lysates,Lane 3: human SiHa whole cell lysates,Lane 4: human THP-1 whole cell lysates,Lane 5: rat testis tissue lysates,Lane 6: rat thymus tissue lysates,Lane 7: mouse testis tissue lysates,Lane 8: mouse thymus tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CSNK2A2 antigen affinity purified polyclonal antibody (#AAA126399) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CSNK2A2 at approximately 39 kDa. The expected band size for CSNK2A2 is at 41 kDa.)

product-image-AAA126399_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of CSNK2A2 using anti-CSNK2A2 antibody (AAA126399).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human 293T whole cell lysates,Lane 3: human SiHa whole cell lysates,Lane 4: human THP-1 whole cell lysates,Lane 5: rat testis tissue lysates,Lane 6: rat thymus tissue lysates,Lane 7: mouse testis tissue lysates,Lane 8: mouse thymus tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CSNK2A2 antigen affinity purified polyclonal antibody (#AAA126399) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CSNK2A2 at approximately 39 kDa. The expected band size for CSNK2A2 is at 41 kDa.)
Related Product Information for anti-CSNK2A2 antibody
Casein kinase II subunit alpha' is an enzyme that in humans is encoded by the CSNK2A2 gene. This gene encodes the alpha', or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythms. This heterotetrameric kinase includes two catalytic subunits, either alpha or alpha', and two regulatory beta subunits. The closely related gene paralog encoding the alpha, or alpha 1 subunit (CSNK2A1, Gene ID: 1457) is found on chromosome 20. An intronic variant in this gene (alpha 2) may be associated with leukocyte telomere length in a South Asian population. A related transcribed pseudogene is found on chromosome 11.
Product Categories/Family for anti-CSNK2A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
350
NCBI Official Full Name
Casein kinase II subunit alpha'
NCBI Official Synonym Full Names
casein kinase 2, alpha prime polypeptide
NCBI Official Symbol
CSNK2A2
NCBI Official Synonym Symbols
CK2A2; CSNK2A1
NCBI Protein Information
casein kinase II subunit alpha'; CK II alpha'
UniProt Protein Name
Casein kinase II subunit alpha'
UniProt Gene Name
CSNK2A2
UniProt Synonym Gene Names
CK2A2; CK II alpha'
UniProt Entry Name
CSK22_HUMAN

Similar Products

Product Notes

The CSNK2A2 csnk2a2 (Catalog #AAA126399) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CSNK2A2 Antibody Picoband reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK2A2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry). Researchers should empirically determine the suitability of the CSNK2A2 csnk2a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSNK2A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.