Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200112_WB8.jpg WB (Western Blot) (WB Suggested Anti-CTBP2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateCTBP2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit CTBP2 Polyclonal Antibody | anti-CTBP2 antibody

CTBP2 antibody - C-terminal region

Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CTBP2, Antibody; CTBP2 antibody - C-terminal region; anti-CTBP2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA
Sequence Length
985
Applicable Applications for anti-CTBP2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CTBP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CTBP2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateCTBP2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA200112_WB8.jpg WB (Western Blot) (WB Suggested Anti-CTBP2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateCTBP2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

WB (Western Blot)

(Host: RabbitTarget Name: CTBP2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA200112_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: CTBP2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CTBP2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA200112_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: CTBP2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Sample Type: Mouse retinaSample Type: outer mouse plexiform layerRed: PrimaryBlue: DAPIPrimary Dilution: 1:200Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L)Secondary Dilution: 1:200Image Submitted by: David ZenisekYale University )

product-image-AAA200112_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type: Mouse retinaSample Type: outer mouse plexiform layerRed: PrimaryBlue: DAPIPrimary Dilution: 1:200Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L)Secondary Dilution: 1:200Image Submitted by: David ZenisekYale University )

IHC (Immunohistochemistry)

(Sample Type: Mouse retinaSample Type: complete mouse retina sectionsRed: PrimaryBlue: DAPIPrimary Dilution: 1:200Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L)Secondary Dilution: 1:200Image Submitted by: David ZenisekYale University )

product-image-AAA200112_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Mouse retinaSample Type: complete mouse retina sectionsRed: PrimaryBlue: DAPIPrimary Dilution: 1:200Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L)Secondary Dilution: 1:200Image Submitted by: David ZenisekYale University )
Related Product Information for anti-CTBP2 antibody
This is a rabbit polyclonal antibody against CTBP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely.This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106kDa
NCBI Official Full Name
C-terminal-binding protein 2 isoform 2
NCBI Official Synonym Full Names
C-terminal binding protein 2
NCBI Official Symbol
CTBP2
NCBI Protein Information
C-terminal-binding protein 2
UniProt Protein Name
C-terminal-binding protein 2
UniProt Gene Name
CTBP2
UniProt Synonym Gene Names
CtBP2
UniProt Entry Name
CTBP2_HUMAN

Similar Products

Product Notes

The CTBP2 ctbp2 (Catalog #AAA200112) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTBP2 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CTBP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CTBP2 ctbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGRIPESLRN CVNKEFFVTS APWSVIDQQA IHPELNGATY RYPPGIVGVA. It is sometimes possible for the material contained within the vial of "CTBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.