Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201126_WB13.jpg WB (Western Blot) (WB Suggested Anti-Cul4b AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Rabbit Cul4b Polyclonal Antibody | anti-CUL4B antibody

Cul4b antibody - C-terminal region

Gene Names
Cul4b; CUL-4B; AA409770; mKIAA0695; 2700050M05Rik
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Cul4b, Antibody; Cul4b antibody - C-terminal region; anti-CUL4B antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYN
Sequence Length
970
Applicable Applications for anti-CUL4B antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Cul4b AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

product-image-AAA201126_WB13.jpg WB (Western Blot) (WB Suggested Anti-Cul4b AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

WB (Western Blot)

(WB Suggested Anti-Cul4b AntibodyPositive Control: Lane 1: 50ug 293T lysate Lane 2: 50ug hCUL4B transfected 293T lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:10,000Submitted by: Mei Yang)

product-image-AAA201126_WB15.jpg WB (Western Blot) (WB Suggested Anti-Cul4b AntibodyPositive Control: Lane 1: 50ug 293T lysate Lane 2: 50ug hCUL4B transfected 293T lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:10,000Submitted by: Mei Yang)
Related Product Information for anti-CUL4B antibody
This is a rabbit polyclonal antibody against Cul4b. It was validated on Western Blot

Target Description: Cul4b is a core component of multiple cullin-RING-based E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition subunit. CUL4B may act within the complex as a scaffold protein, contributing to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme.
Product Categories/Family for anti-CUL4B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
111kDa
NCBI Official Full Name
cullin-4B
NCBI Official Synonym Full Names
cullin 4B
NCBI Official Symbol
Cul4b
NCBI Official Synonym Symbols
CUL-4B; AA409770; mKIAA0695; 2700050M05Rik
NCBI Protein Information
cullin-4B
UniProt Protein Name
Cullin-4B
UniProt Gene Name
Cul4b
UniProt Synonym Gene Names
mKIAA0695; CUL-4B
UniProt Entry Name
CUL4B_MOUSE

Similar Products

Product Notes

The CUL4B cul4b (Catalog #AAA201126) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cul4b antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Cul4b can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CUL4B cul4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQMKETVEEQ ASTTERVFQD RQYQIDAAIV RIMKMRKTLS HNLLVSEVYN. It is sometimes possible for the material contained within the vial of "Cul4b, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.