Rabbit CXCL14 Polyclonal Antibody | anti-CXCL14 antibody
CXCL14 antibody - middle region
Gene Names
CXCL14; KEC; KS1; BMAC; BRAK; NJAC; MIP2G; MIP-2g; SCYB14
Reactivity
Cow, Dog, Guinea Pig, Horse, Rat
Applications
Western Blot, Immunohistochemistry
Synonyms
CXCL14, Antibody; CXCL14 antibody - middle region; anti-CXCL14 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Rat
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE
Sequence Length
111
Applicable Applications for anti-CXCL14 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CXCL14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CXCL14 antibody
This is a rabbit polyclonal antibody against CXCL14. It was validated on Western Blot
Target Description: CXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Target Description: CXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Product Categories/Family for anti-CXCL14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9kDa
NCBI Official Full Name
C-X-C motif chemokine 14
NCBI Official Synonym Full Names
C-X-C motif chemokine ligand 14
NCBI Official Symbol
CXCL14
NCBI Official Synonym Symbols
KEC; KS1; BMAC; BRAK; NJAC; MIP2G; MIP-2g; SCYB14
NCBI Protein Information
C-X-C motif chemokine 14
UniProt Protein Name
C-X-C motif chemokine 14
UniProt Gene Name
CXCL14
UniProt Synonym Gene Names
MIP2G; NJAC; SCYB14
UniProt Entry Name
CXL14_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CXCL14 cxcl14 (Catalog #AAA201691) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCL14 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CXCL14 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CXCL14 cxcl14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHCEEKMVII TTKSVSRYRG QEHCLHPKLQ STKRFIKWYN AWNEKRRVYE. It is sometimes possible for the material contained within the vial of "CXCL14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
