Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283299_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Mouse brain tissue using CYLD Rabbit pAb (AAA283299) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

Rabbit anti-Human CYLD Polyclonal Antibody | anti-CYLD antibody

CYLD Rabbit pAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
CYLD, Antibody; CYLD Rabbit pAb; EAC; MFT; SBS; TEM; BRSS; CDMT; MFT1; CYLD1; CYLDI; USPL2; FTDALS8; anti-CYLD antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDV
Applicable Applications for anti-CYLD antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence)
Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human CYLD (NP_056062.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of paraffin-embedded Mouse brain tissue using CYLD Rabbit pAb (AAA283299) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA283299_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Mouse brain tissue using CYLD Rabbit pAb (AAA283299) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A-431 cells using CYLD Rabbit pAb (AAA283299) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283299_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A-431 cells using CYLD Rabbit pAb (AAA283299) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
Related Product Information for anti-CYLD antibody
This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 107kDa
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase CYLD
UniProt Gene Name
CYLD
UniProt Synonym Gene Names
CYLD1; KIAA0849
UniProt Entry Name
CYLD_HUMAN

Similar Products

Product Notes

The CYLD cyld (Catalog #AAA283299) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYLD Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYLD can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the CYLD cyld for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSGLWSQEK VTSPYWEERI FYLLLQECSV TDKQTQKLLK VPKGSIGQYI QDRSVGHSRI PSAKGKKNQI GLKILEQPHA VLFVDEKDVV EINEKFTELL LAITNCEERF SLFKNRNRLS KGLQIDV. It is sometimes possible for the material contained within the vial of "CYLD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.