Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200991_WB11.jpg WB (Western Blot) (WB Suggested Anti-CYP21A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit CYP21A2 Polyclonal Antibody | anti-CYP21A2 antibody

CYP21A2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CYP21A2; CAH1; CPS1; CA21H; CYP21; CYP21B; P450c21B
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CYP21A2, Antibody; CYP21A2 antibody - C-terminal region; anti-CYP21A2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA
Sequence Length
495
Applicable Applications for anti-CYP21A2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 80%; Human: 100%; Pig: 92%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CYP21A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CYP21A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

product-image-AAA200991_WB11.jpg WB (Western Blot) (WB Suggested Anti-CYP21A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

IHC (Immunohiostchemistry)

(Sample Type: Monkey vaginaSample Type :Monkey vaginaPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: CYP21A2 Blue: NucleusGene Name:CYP21A2Submitted by:Jonathan Bertin, Endoceutics Inc.)

product-image-AAA200991_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type: Monkey vaginaSample Type :Monkey vaginaPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: CYP21A2 Blue: NucleusGene Name:CYP21A2Submitted by:Jonathan Bertin, Endoceutics Inc.)

IHC (Immunohistochemistry)

(Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: CYP21A2 Blue: NucleusGene Name:CYP21A2Submitted by:Jonathan Bertin, Endoceutics Inc.)

product-image-AAA200991_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: CYP21A2 Blue: NucleusGene Name:CYP21A2Submitted by:Jonathan Bertin, Endoceutics Inc.)
Related Product Information for anti-CYP21A2 antibody
This is a rabbit polyclonal antibody against CYP21A2. It was validated on Western Blot

Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CYP21A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
steroid 21-hydroxylase isoform a
NCBI Official Synonym Full Names
cytochrome P450 family 21 subfamily A member 2
NCBI Official Symbol
CYP21A2
NCBI Official Synonym Symbols
CAH1; CPS1; CA21H; CYP21; CYP21B; P450c21B
NCBI Protein Information
steroid 21-hydroxylase
UniProt Protein Name
Cytochrome P450 21-hydroxylase
UniProt Gene Name
P450-CYP21B
UniProt Synonym Gene Names
CYP21A2
UniProt Entry Name
Q16874_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CYP21A2 p450-cyp21b (Catalog #AAA200991) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP21A2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Pig, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CYP21A2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CYP21A2 p450-cyp21b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQQRLQEELD HELGPGASSS RVPYKDRARL PLLNATIAEV LRLRPVVPLA. It is sometimes possible for the material contained within the vial of "CYP21A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.