Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200992_WB15.jpg WB (Western Blot) (WB Suggested Anti-CYP24A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MDA-MB-435S cell lysate)

Rabbit CYP24A1 Polyclonal Antibody | anti-CYP24A1 antibody

CYP24A1 antibody - C-terminal region

Gene Names
CYP24A1; CP24; HCAI; CYP24; HCINF1; P450-CC24
Reactivity
Reacts with: Human
Predicted reacts with: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CYP24A1, Antibody; CYP24A1 antibody - C-terminal region; anti-CYP24A1 antibody
Ordering
Host
Rabbit
Reactivity
Reacts with: Human
Predicted reacts with: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLS
Sequence Length
514
Applicable Applications for anti-CYP24A1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Predicted homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CYP24A1
Protein Interaction
Dlg4; UBC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CYP24A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MDA-MB-435S cell lysate)

product-image-AAA200992_WB15.jpg WB (Western Blot) (WB Suggested Anti-CYP24A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MDA-MB-435S cell lysate)
Related Product Information for anti-CYP24A1 antibody
This is a rabbit polyclonal antibody against CYP24A1. It was validated on Western Blot

Target Description: CYP24A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system.
Product Categories/Family for anti-CYP24A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial isoform 1
NCBI Official Synonym Full Names
cytochrome P450 family 24 subfamily A member 1
NCBI Official Symbol
CYP24A1
NCBI Official Synonym Symbols
CP24; HCAI; CYP24; HCINF1; P450-CC24
NCBI Protein Information
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
UniProt Protein Name
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
UniProt Gene Name
CYP24A1
UniProt Synonym Gene Names
CYP24; 24-OHase
UniProt Entry Name
CP24A_HUMAN

Similar Products

Product Notes

The CYP24A1 cyp24a1 (Catalog #AAA200992) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP24A1 antibody - C-terminal region reacts with Reacts with: Human Predicted reacts with: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CYP24A1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CYP24A1 cyp24a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNTKVWQDHT LAWDTIFKSV KACIDNRLEK YSQQPSADFL CDIYHQNRLS. It is sometimes possible for the material contained within the vial of "CYP24A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.