Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281274_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CYSLTR1 antibody (AAA281274) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)

Rabbit CYSLTR1 Polyclonal Antibody | anti-CYSLTR1 antibody

CYSLTR1 Polyclonal Antibody

Gene Names
CYSLTR1; CYSLT1; CYSLTR; CYSLT1R; HMTMF81
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CYSLTR1, Antibody; CYSLTR1 Polyclonal Antibody; CYSLTR1; CYSLT1; CYSLT1R; CYSLTR; HMTMF81; cysteinyl leukotriene receptor 1; anti-CYSLTR1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLST
Sequence Length
337
Applicable Applications for anti-CYSLTR1 antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYSLTR1 (NP_006630.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CYSLTR1 antibody (AAA281274) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)

product-image-AAA281274_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CYSLTR1 antibody (AAA281274) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)
Related Product Information for anti-CYSLTR1 antibody
This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CYSLTR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 38kDa
Observed: 38kDa
NCBI Official Full Name
cysteinyl leukotriene receptor 1
NCBI Official Synonym Full Names
cysteinyl leukotriene receptor 1
NCBI Official Symbol
CYSLTR1
NCBI Official Synonym Symbols
CYSLT1; CYSLTR; CYSLT1R; HMTMF81
NCBI Protein Information
cysteinyl leukotriene receptor 1
UniProt Protein Name
Cysteinyl leukotriene receptor 1
UniProt Gene Name
CYSLTR1
UniProt Synonym Gene Names
CYSLT1; CysLTR1; LTD4 receptor

Similar Products

Product Notes

The CYSLTR1 cysltr1 (Catalog #AAA281274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYSLTR1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CYSLTR1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CYSLTR1 cysltr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDETGNLTVS SATCHDTIDD FRNQVYSTLY SMISVVGFFG NGFVLYVLIK TYHKKSAFQV YMINLAVADL LCVCTLPLRV VYYVHKGIWL FGDFLCRLST. It is sometimes possible for the material contained within the vial of "CYSLTR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.