Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282390_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (AAA282390). Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Mouse Cytokeratin 20 (KRT20) Polyclonal Antibody | anti-KRT20 antibody

Cytokeratin 20 (KRT20) Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
KRT20; K20; CD20; CK20; CK-20; KRT21
Reactivity
Human, Mouse
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Cytokeratin 20 (KRT20), Antibody; Cytokeratin 20 (KRT20) Rabbit pAb; K20; CD20; CK20; CK-20; KRT21; anti-KRT20 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
KYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIELQSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI
Applicable Applications for anti-KRT20 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Cellular Location
Cytoplasm
Research Area
Cancer, Tumor biomarkers, Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Intermediate Filaments
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 245-424 of human Cytokeratin 20 (KRT20)(NP_061883.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (AAA282390). Blue: DAPI for nuclear staining.)

product-image-AAA282390_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (AAA282390). Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (AAA282390) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282390_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (AAA282390) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (AAA282390). Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA282390_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (AAA282390). Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-KRT20 antibody
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.
Product Categories/Family for anti-KRT20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,487 Da
NCBI Official Full Name
keratin, type I cytoskeletal 20
NCBI Official Synonym Full Names
keratin 20
NCBI Official Symbol
KRT20
NCBI Official Synonym Symbols
K20; CD20; CK20; CK-20; KRT21
NCBI Protein Information
keratin, type I cytoskeletal 20; keratin-20; protein IT; cytokeratin 20; cytokeratin-20
UniProt Protein Name
Keratin, type I cytoskeletal 20
UniProt Gene Name
KRT20
UniProt Synonym Gene Names
CK-20; K20
UniProt Entry Name
K1C20_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KRT20 krt20 (Catalog #AAA282390) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cytokeratin 20 (KRT20) Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Cytokeratin 20 (KRT20) can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the KRT20 krt20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KYEVMAQKNL QEAKEQFERQ TAVLQQQVTV NTEELKGTEV QLTELRRTSQ SLEIELQSHL SMKESLEHTL EETKARYSSQ LANLQSLLSS LEAQLMQIRS NMERQNNEYH ILLDIKTRLE QEIATYRRLL EGEDVKTTEY QLSTLEERDI KKTRKIKTVV QEVVDGKVVS SEVKEVEENI. It is sometimes possible for the material contained within the vial of "Cytokeratin 20 (KRT20), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.