Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46718_IHC11.jpg IHC (Immunohistochemisry) (Cytokeratin 5 was detected in paraffin-embedded sections of human oesophagus squama cancer tissues using rabbit anti- Cytokeratin 5 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Cytokeratin 5 Polyclonal Antibody | anti-KRT5 antibody

Anti-Cytokeratin 5 Antibody

Average rating 0.0
No ratings yet
Gene Names
KRT5; K5; CK5; DDD; DDD1; EBS2; KRT5A
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Cytokeratin 5, Antibody; Anti-Cytokeratin 5 Antibody; CK-5; CK5; Cytokeratin-5; Cytokeratin5; DDD; DDD1; EBS2; K5; Keratin 5; Keratin; Keratin-5; Keratin5; KRT 5; Krt5; KRT5A; P13647; Keratin, type II cytoskeletal 5; anti-KRT5 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
590
Applicable Applications for anti-KRT5 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5 (286-317aa KVELEAKVDALMDEINFMKMFFDAELSQMQTH), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Cytokeratin 5 was detected in paraffin-embedded sections of human oesophagus squama cancer tissues using rabbit anti- Cytokeratin 5 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46718_IHC11.jpg IHC (Immunohistochemisry) (Cytokeratin 5 was detected in paraffin-embedded sections of human oesophagus squama cancer tissues using rabbit anti- Cytokeratin 5 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(Cytokeratin 5 was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- Cytokeratin 5 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46718_IHC13.jpg IHC (Immunohiostchemistry) (Cytokeratin 5 was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- Cytokeratin 5 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of Cytokeratin 5 expression in rat kidney extract (lane 1), COLO320 whole cell lysates (lane 2) and HELA whole cell lysates (lane 3). Cytokeratin 5 at 62KD was detected using rabbit anti- Cytokeratin 5 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46718_WB15.jpg WB (Western Blot) (Western blot analysis of Cytokeratin 5 expression in rat kidney extract (lane 1), COLO320 whole cell lysates (lane 2) and HELA whole cell lysates (lane 3). Cytokeratin 5 at 62KD was detected using rabbit anti- Cytokeratin 5 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-KRT5 antibody
Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 5(KRT5) detection.
Background: Cytokeratin 5, also known as KRT5, K5, or CK5, is a protein that is encoded in humans by the KRT5 gene. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the basal layer of the epidermis with family member KRT14. Mutations in these genes have been associated with a complex of diseases termed epidermolysis bullosa simplex. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
References
1. "Entrez Gene: KRT5 keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types)".
2. Eckert RL, Rorke EA (Jun 1988). "The sequence of the human epidermal 58-kD (#5) type II keratin reveals an absence of 5' upstream sequence conservation between coexpressed epidermal keratins". Dna. 7 (5): 337-45.
3. Lersch R, Fuchs E (Jan 1988). "Sequence and expression of a type II keratin, K5, in human epidermal cells". Molecular and Cellular Biology. 8 (1): 486-93.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,378 Da
NCBI Official Full Name
keratin, type II cytoskeletal 5
NCBI Official Synonym Full Names
keratin 5
NCBI Official Symbol
KRT5
NCBI Official Synonym Symbols
K5; CK5; DDD; DDD1; EBS2; KRT5A
NCBI Protein Information
keratin, type II cytoskeletal 5
UniProt Protein Name
Keratin, type II cytoskeletal 5
UniProt Gene Name
KRT5
UniProt Synonym Gene Names
CK-5; K5

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KRT5 krt5 (Catalog #AAA46718) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Cytokeratin 5 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cytokeratin 5 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the KRT5 krt5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cytokeratin 5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.