Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46321_IHC10.jpg IHC (Immunohistochemistry) (DARPP32 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

DARPP32 Polyclonal Antibody | anti-DARPP32 antibody

Anti-DARPP32 Antibody

Gene Names
PPP1R1B; DARPP32; DARPP-32
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
DARPP32, Antibody; Anti-DARPP32 Antibody; Protein phosphatase 1 regulatory subunit 1B; DARPP 32; DARPP-32; Dopamine and cAMP regulated neuronal phosphoprotein 32; Dopamine and cAMP regulated neuronal phosphoprotein; Dopamine and cAMP regulated phosphoprotein; Dopamine and cAMP regulated phosphoprotein DARPP 32; Dopamine and cAMP regulated phosphoprotein DARPP32; Dopamine- and cAMP-regulated neuronal phosphoprotein; FLJ20940; IPPD; Neuronal phosphoprotein DARPP 32; PPP1R1B; PPR1B_HUMAN; Protein phosphatase 1 regulatory (inhibitor) subunit 1B; protein phosphatase 1 regulatory inhibitor subunit 1B; anti-DARPP32 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
168
Applicable Applications for anti-DARPP32 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(DARPP32 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46321_IHC10.jpg IHC (Immunohistochemistry) (DARPP32 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(DARPP32 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46321_IHC11.jpg IHC (Immunohistochemisry) (DARPP32 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(DARPP32 was detected in paraffin-embedded sections of mouse pancreas tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46321_IHC13.jpg IHC (Immunohiostchemistry) (DARPP32 was detected in paraffin-embedded sections of mouse pancreas tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of DARPP32 expression in rat brain extract (lane 1), SW620 whole cell lysates (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). DARPP32 at 34KD, 39KD was detected using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46321_WB15.jpg WB (Western Blot) (Western blot analysis of DARPP32 expression in rat brain extract (lane 1), SW620 whole cell lysates (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). DARPP32 at 34KD, 39KD was detected using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-DARPP32 antibody
Description: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32)". 2. Brené S, Lindefors N, Ehrlich M, Taubes T, Horiuchi A, Kopp J, Hall H, Sedvall G, Greengard P, Persson H (March 1994). "Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue". J. Neurosci. 14 (3 Pt 1): 985-98. 3. Ouimet CC, Greengard P (February 1990). "Distribution of DARPP-32 in the basal ganglia: an electron microscopic study". J. Neurocytol. 19 (1): 39-52.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,738 Da
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 1B isoform 2
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory inhibitor subunit 1B
NCBI Official Symbol
PPP1R1B
NCBI Official Synonym Symbols
DARPP32; DARPP-32
NCBI Protein Information
protein phosphatase 1 regulatory subunit 1B
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 1B
UniProt Gene Name
PPP1R1B
UniProt Synonym Gene Names
DARPP32
UniProt Entry Name
PPR1B_HUMAN

Similar Products

Product Notes

The DARPP32 ppp1r1b (Catalog #AAA46321) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-DARPP32 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DARPP32 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the DARPP32 ppp1r1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DARPP32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.