Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198632_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: DAZLSample Type: Stomach tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit DAZL Polyclonal Antibody | anti-DAZL antibody

DAZL Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
DAZL; DAZH; DAZL1; DAZLA; SPGYLA
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DAZL, Antibody; DAZL Antibody - C-terminal region; anti-DAZL antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFR
Sequence Length
295
Applicable Applications for anti-DAZL antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DAZL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: DAZLSample Type: Stomach tumor lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA198632_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: DAZLSample Type: Stomach tumor lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: DAZLSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA198632_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: DAZLSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-DAZL antibody
This is a rabbit polyclonal antibody against DAZL. It was validated on Western Blot

Target Description: DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. DAZL is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of the autosomal gene encoding DAZL during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in the Dazl gene have been linked to severe spermatogenic failure and infertility in males.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
deleted in azoospermia-like isoform 2
NCBI Official Synonym Full Names
deleted in azoospermia like
NCBI Official Symbol
DAZL
NCBI Official Synonym Symbols
DAZH; DAZL1; DAZLA; SPGYLA
NCBI Protein Information
deleted in azoospermia-like
UniProt Protein Name
Deleted in azoospermia-like
UniProt Gene Name
DAZL
UniProt Synonym Gene Names
DAZH; DAZL1; DAZLA; SPGYLA
UniProt Entry Name
DAZL_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DAZL dazl (Catalog #AAA198632) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DAZL Antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DAZL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DAZL dazl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPSGNGPQKK SVDRSIQTVV SCLFNPENRL RNSVVTQDDY FKDKRVHHFR. It is sometimes possible for the material contained within the vial of "DAZL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.