Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23544_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of formalin-fixed, paraffin-embedded human skin tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Rabbit DBT Polyclonal Antibody | anti-DBT antibody

DBT antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
DBT; E2; E2B; BCATE2; BCKADE2; BCKAD-E2; BCOADC-E2
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
DBT, Antibody; DBT antibody - N-terminal region; anti-DBT antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW
Sequence Length
482
Applicable Applications for anti-DBT antibody
WB (Western Blot), IHC (Immunohistochemistry)
Application Notes
IHC Information: Skin
IHC Information: Spleen
IHC Information: Kidney
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DBT
Protein Size (# AA)
482 amino acids
Protein Interactions
HUWE1; UBC; PARK2; IFIT2; ABCC1; DLD; AGO4; AGO3; SRRM2; USP16; ADI1;
Blocking Peptide
For anti-DBT (AAA23544) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry of formalin-fixed, paraffin-embedded human skin tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA23544_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of formalin-fixed, paraffin-embedded human skin tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

IHC (Immunohistochemistry)

(Immunohistochemistry of formalin-fixed, paraffin-embedded human kidney tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA23544_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of formalin-fixed, paraffin-embedded human kidney tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

IHC (Immunohistochemistry)

(Immunohistochemistry of formalin-fixed, paraffin-embedded human spleen tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA23544_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of formalin-fixed, paraffin-embedded human spleen tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

WB (Western Blot)

(WB Suggested Anti-DBT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateThere is BioGPS gene expression data showing that DBT is expressed in HT1080)

product-image-AAA23544_WB3.jpg WB (Western Blot) (WB Suggested Anti-DBT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateThere is BioGPS gene expression data showing that DBT is expressed in HT1080)

WB (Western Blot)

(Host: RabbitTarget: DBTPositive control (+): Human Liver (LI)Negative control (-): HeLa Cell Lysate (HL)Antibody concentration: 1ug/ml)

product-image-AAA23544_WB2.jpg WB (Western Blot) (Host: RabbitTarget: DBTPositive control (+): Human Liver (LI)Negative control (-): HeLa Cell Lysate (HL)Antibody concentration: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: DBTSample Tissue: Human THP-1 Whole CellAntibody Dilution: 0.5ug/ml)

product-image-AAA23544_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: DBTSample Tissue: Human THP-1 Whole CellAntibody Dilution: 0.5ug/ml)
Related Product Information for anti-DBT antibody
This is a rabbit polyclonal antibody against DBT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought to be composed of a core of 24 transacylase (E2) subunits, and associated decarboxylase (E1), dehydrogenase (E3), and regulatory subunits. This gene encodes the transacylase (E2) subunit. Mutations in this gene result in maple syrup urine disease, type 2. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial
NCBI Official Synonym Full Names
dihydrolipoamide branched chain transacylase E2
NCBI Official Symbol
DBT
NCBI Official Synonym Symbols
E2; E2B; BCATE2; BCKADE2; BCKAD-E2; BCOADC-E2
NCBI Protein Information
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial
UniProt Protein Name
Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial
UniProt Gene Name
DBT
UniProt Entry Name
ODB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DBT dbt (Catalog #AAA23544) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DBT antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DBT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). IHC Information: Skin IHC Information: Spleen IHC Information: Kidney. Researchers should empirically determine the suitability of the DBT dbt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NYVCFFGYPS FKYSHPHHFL KTTAALRGQV VQFKLSDIGE GIREVTVKEW. It is sometimes possible for the material contained within the vial of "DBT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.