Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198867_WB13.jpg WB (Western Blot) (WB Suggested Anti-DCX Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit DCX Polyclonal Antibody | anti-DCX antibody

DCX antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
DCX; DC; DBCN; LISX; SCLH; XLIS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
DCX, Antibody; DCX antibody - C-terminal region; anti-DCX antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR
Sequence Length
365
Applicable Applications for anti-DCX antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DCX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DCX Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA198867_WB13.jpg WB (Western Blot) (WB Suggested Anti-DCX Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Sample Type :Mouse spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Anti-rabbit-Alexa 594Secondary Antibody Dilution :1:500Color/Signal Descriptions :Red: DCX Blue:DAPIGene Name :DCXSubmitted by :Anonymous)

product-image-AAA198867_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Mouse spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Anti-rabbit-Alexa 594Secondary Antibody Dilution :1:500Color/Signal Descriptions :Red: DCX Blue:DAPIGene Name :DCXSubmitted by :Anonymous)
Related Product Information for anti-DCX antibody
This is a rabbit polyclonal antibody against DCX. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. DCX is a cytoplasmic protein which appears to direct neuronal migration by regulating the organization and stability of microtubules. The protein contains two doublecortin domains, which bind microtubules. In addition, DCX interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex.In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The protein encoded by this gene is a cytoplasmic protein which appears to direct neuronal migration by regulating the organization and stability of microtubules. The encoded protein contains two doublecortin domains, which bind microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene are a cause of X-linked lissencephaly. Multiple transcript variants encoding at least three different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
neuronal migration protein doublecortin isoform b
NCBI Official Synonym Full Names
doublecortin
NCBI Official Symbol
DCX
NCBI Official Synonym Symbols
DC; DBCN; LISX; SCLH; XLIS
NCBI Protein Information
neuronal migration protein doublecortin
UniProt Protein Name
Neuronal migration protein doublecortin
UniProt Gene Name
DCX
UniProt Synonym Gene Names
DBCN; LISX; Lis-X
UniProt Entry Name
DCX_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DCX dcx (Catalog #AAA198867) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCX antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DCX can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the DCX dcx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEKFRYAQDD FSLDENECRV MKGNPSATAG PKASPTPQKT SAKSPGPMRR. It is sometimes possible for the material contained within the vial of "DCX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.