Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46645_IHC11.jpg IHC (Immunohistochemisry) (DDAH2 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit DDAH2 Polyclonal Antibody | anti-DDAH2 antibody

Anti-DDAH2 Antibody

Average rating 0.0
No ratings yet
Gene Names
DDAH2; G6a; DDAH; NG30; DDAHII; HEL-S-277
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
DDAH2, Antibody; Anti-DDAH2 Antibody; DDAH; DDAH II; DDAHII; DDAH2; DDAH-2; DDAH 2; Dimethylargininase 2; Dimethylargininase-2; G6a; NG30; Protein G6a; S phase protein; S-phase protein; O95865; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; dimethylarginine dimethylaminohydrolase 2; anti-DDAH2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
285
Applicable Applications for anti-DDAH2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR), different from the related mouse and rat sequences by three amino acids.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(DDAH2 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46645_IHC11.jpg IHC (Immunohistochemisry) (DDAH2 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(DDAH2 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46645_IHC13.jpg IHC (Immunohiostchemistry) (DDAH2 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of DDAH2 expression in rat lung extract (lane 1), mouse lung extract (lane 2) and human placenta extract (lane 3). DDAH2 at 27KD was detected using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46645_WB15.jpg WB (Western Blot) (Western blot analysis of DDAH2 expression in rat lung extract (lane 1), mouse lung extract (lane 2) and human placenta extract (lane 3). DDAH2 at 27KD was detected using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-DDAH2 antibody
Rabbit IgG polyclonal antibody for N (G),N (G)-dimethylarginine dimethylaminohydrolase 2 (DDAH2) detection.
Background: DDAH2 is known as dimethylarginine dimethylaminohydrolase 2 which is mapped to 6p21.3 by radiation hybrid and FISH analysis. This gene encodes a dimethylarginine dimethylaminohydrolase. DDAH2 functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants.
References
1. Leiper, J. M,, Santa Maria, J., Chubb, A., MacAllister, R. J., Charles, I. G., Whitley, G. S., Vallance, P. Identification of two human dimethylarginine dimethylaminohydrolases with distinct tissue distributions and homology with microbial arginine deiminases.Biochem. J. 343: 209-214, 1999.
2. Smith, C. L., Birdsey, G. M., Anthony, S., Arrigoni, F. I., Leiper, J. M., Vallance, P. Dimethylarginine dimethylaminohydrolase activity modulates ADMA levels, VEGF expression, and cell phenotype. Biochem. Biophys. Res. Commun. 308: 984-989, 2003.
3. Tran, C. T. L., Fox, M. F., Vallance, P., Leiper, J. M. Chromosomal localization, gene structure, and expression pattern of DDAH1: comparison with DDAH2 and implications for evolutionary origins. Genomics 68: 101-105, 2000.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,644 Da
NCBI Official Full Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
NCBI Official Synonym Full Names
dimethylarginine dimethylaminohydrolase 2
NCBI Official Symbol
DDAH2
NCBI Official Synonym Symbols
G6a; DDAH; NG30; DDAHII; HEL-S-277
NCBI Protein Information
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
UniProt Protein Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
UniProt Gene Name
DDAH2
UniProt Synonym Gene Names
DDAH; G6A; NG30; DDAH-2; Dimethylarginine dimethylaminohydrolase 2
UniProt Entry Name
DDAH2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DDAH2 ddah2 (Catalog #AAA46645) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-DDAH2 Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's DDAH2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the DDAH2 ddah2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDAH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.