Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200837_WB10.jpg WB (Western Blot) (WB Suggested Anti-DDAH2 Antibody Titration: 1 ug/mlPositive Control: Fetal Brain Lysate)

Rabbit DDAH2 Polyclonal Antibody | anti-DDAH2 antibody

DDAH2 antibody - N-terminal region

Gene Names
DDAH2; G6a; DDAH; NG30; DDAHII; HEL-S-277
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
DDAH2, Antibody; DDAH2 antibody - N-terminal region; anti-DDAH2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG
Sequence Length
285
Applicable Applications for anti-DDAH2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DDAH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DDAH2 Antibody Titration: 1 ug/mlPositive Control: Fetal Brain Lysate)

product-image-AAA200837_WB10.jpg WB (Western Blot) (WB Suggested Anti-DDAH2 Antibody Titration: 1 ug/mlPositive Control: Fetal Brain Lysate)

WB (Western Blot)

(Host: MouseTarget Name: DDAH2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA200837_WB11.jpg WB (Western Blot) (Host: MouseTarget Name: DDAH2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Immunohistochemistry with Human Uterus lysate tissue at an antibody concentration of 5.0ug/ml using anti-DDAH2 antibody)

product-image-AAA200837_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry with Human Uterus lysate tissue at an antibody concentration of 5.0ug/ml using anti-DDAH2 antibody)

IHC (Immunohistochemistry)

(Human Uterus)

product-image-AAA200837_IHC15.jpg IHC (Immunohistochemistry) (Human Uterus)
Related Product Information for anti-DDAH2 antibody
This is a rabbit polyclonal antibody against DDAH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
NCBI Official Synonym Full Names
dimethylarginine dimethylaminohydrolase 2
NCBI Official Symbol
DDAH2
NCBI Official Synonym Symbols
G6a; DDAH; NG30; DDAHII; HEL-S-277
NCBI Protein Information
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
UniProt Protein Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
UniProt Gene Name
DDAH2
UniProt Synonym Gene Names
DDAH; G6A; NG30; DDAH-2; Dimethylarginine dimethylaminohydrolase 2
UniProt Entry Name
DDAH2_HUMAN

Similar Products

Product Notes

The DDAH2 ddah2 (Catalog #AAA200837) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDAH2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DDAH2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the DDAH2 ddah2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGTPGEGLGR CSHALIRGVP ESLASGEGAG AGLPALDLAK AQREHGVLGG. It is sometimes possible for the material contained within the vial of "DDAH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.