Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA21308_IHC6.jpg IHC (Immunohistchemistry) (DDX/AKR1C3 Antibody-Immunohistochemistry of paraffin-embedded rat kidney using AKR1C3 antibody at dilution of 1:100 (200x lens).)

Rabbit anti-Human DDX/AKR1C3 Polyclonal Antibody | anti-AKR1C3 antibody

DDX/AKR1C3 Rabbit anti-Human Polyclonal Antibody

Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
DDX/AKR1C3, Antibody; DDX/AKR1C3 Rabbit anti-Human Polyclonal Antibody; IHC-plus DDX/AKR1C3 Antibody; AKR1C3; 3-alpha-HSD type 2; 17-beta-HSD 5; 3-alpha-HSD type II; brain; DD3; DDH1; DDX; Dihydrodiol dehydrogenase 3; Dihydrodiol dehydrogenase X; DD-3; HA1753; HAKRe; HAKRB; HSD17B5; KIAA0119; Kia0119; Prostaglandin F synthase; PGFS; Truncated aldoketo reductase a; HluPGFS; Indanol dehydrogenase; anti-AKR1C3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human DDX/AKR1C3
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration
1.34mg/ml (varies by lot)
Applicable Applications for anti-AKR1C3 antibody
IHC (Immunohistochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC: 1:50-1:200
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 23kDa/36kDa, while the observed MW by Western blot was 35kDa.
Target
Human DDX/AKR1C3
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C3 (NP_003730.4). MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistchemistry)

(DDX/AKR1C3 Antibody-Immunohistochemistry of paraffin-embedded rat kidney using AKR1C3 antibody at dilution of 1:100 (200x lens).)

product-image-AAA21308_IHC6.jpg IHC (Immunohistchemistry) (DDX/AKR1C3 Antibody-Immunohistochemistry of paraffin-embedded rat kidney using AKR1C3 antibody at dilution of 1:100 (200x lens).)

IHC (Immunohistochemistry)

(DDX/AKR1C3 Antibody-Immunohistochemistry of paraffin-embedded human esophageal cancer using AKR1C3 antibody at dilution of 1:100 (200x lens).)

product-image-AAA21308_IHC5.jpg IHC (Immunohistochemistry) (DDX/AKR1C3 Antibody-Immunohistochemistry of paraffin-embedded human esophageal cancer using AKR1C3 antibody at dilution of 1:100 (200x lens).)

IHC (Immunohistochemistry)

(DDX/AKR1C3 Antibody-Immunohistochemistry of paraffin-embedded rat heart.)

product-image-AAA21308_IHC4.jpg IHC (Immunohistochemistry) (DDX/AKR1C3 Antibody-Immunohistochemistry of paraffin-embedded rat heart.)

IHC (Immunohistochemistry)

(DDX/AKR1C3 Antibody-Immunohistochemistry of paraffin-embedded rat brain using AKR1C3 antibody at dilution of 1:100 (200x lens).)

product-image-AAA21308_IHC3.jpg IHC (Immunohistochemistry) (DDX/AKR1C3 Antibody-Immunohistochemistry of paraffin-embedded rat brain using AKR1C3 antibody at dilution of 1:100 (200x lens).)

IHC (Immunohistochemistry)

(DDX/AKR1C3 Antibody-Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21308_IHC2.jpg IHC (Immunohistochemistry) (DDX/AKR1C3 Antibody-Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(DDX/AKR1C3 Antibody-Western blot analysis of extracts of various cell lines, using AKR1C3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)

product-image-AAA21308_WB.jpg WB (Western Blot) (DDX/AKR1C3 Antibody-Western blot analysis of extracts of various cell lines, using AKR1C3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)
Related Product Information for anti-AKR1C3 antibody
AKR1C3 antibody is an unconjugated rabbit polyclonal antibody to human AKR1C3 (DDX). Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
UniProt Protein Name
Aldo-keto reductase family 1 member C3
UniProt Gene Name
AKR1C3
UniProt Synonym Gene Names
DDH1; HSD17B5; KIAA0119; PGFS; 17-beta-HSD 5; 3-alpha-HSD type 2; DD-3; DD3; PGFS
UniProt Entry Name
AK1C3_HUMAN

Similar Products

Product Notes

The AKR1C3 akr1c3 (Catalog #AAA21308) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX/AKR1C3 Rabbit anti-Human Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDX/AKR1C3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), IHC (Immunohistochemistry), WB (Western Blot). IHC: 1:50-1:200 IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 23kDa/36kDa, while the observed MW by Western blot was 35kDa. Researchers should empirically determine the suitability of the AKR1C3 akr1c3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDX/AKR1C3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.