Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28263_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using DDX5 antibody. Blue: DAPI for nuclear staining.)

Rabbit DDX5 Polyclonal Antibody | anti-DDX5 antibody

DDX5 Polyclonal Antibody

Gene Names
DDX5; p68; HLR1; G17P1; HUMP68
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
DDX5, Antibody; DDX5 Polyclonal Antibody; G17P1; HLR1; HUMP68; p68; anti-DDX5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLD
Sequence Length
614
Applicable Applications for anti-DDX5 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human DDX5
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using DDX5 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA28263_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using DDX5 antibody. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse liver using DDX5 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28263_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse liver using DDX5 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using DDX5 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28263_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse lung using DDX5 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human esophagus using DDX5 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28263_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human esophagus using DDX5 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human oophoroma using DDX5 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28263_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human oophoroma using DDX5 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using DDX5 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28263_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using DDX5 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat lung using DDX5 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28263_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using DDX5 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using DDX5 antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA28263_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using DDX5 antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Related Product Information for anti-DDX5 antibody
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-DDX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 60kDa; 69kDa
Observed: 69kDa
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX5 isoform a
NCBI Official Synonym Full Names
DEAD-box helicase 5
NCBI Official Symbol
DDX5
NCBI Official Synonym Symbols
p68; HLR1; G17P1; HUMP68
NCBI Protein Information
probable ATP-dependent RNA helicase DDX5
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX5
UniProt Gene Name
DDX5
UniProt Synonym Gene Names
G17P1; HELR; HLR1

Similar Products

Product Notes

The DDX5 ddx5 (Catalog #AAA28263) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX5 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DDX5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the DDX5 ddx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGYSSDRDR GRDRGFGAPR FGGSRAGPLS GKKFGNPGEK LVKKKWNLDE LPKFEKNFYQ EHPDLARRTA QEVETYRRSK EITVRGHNCP KPVLNFYEAN FPANVMDVIA RQNFTEPTAI QAQGWPVALS GLDMVGVAQT GSGKTLSYLL PAIVHINHQP FLERGDGPIC LVLAPTRELA QQVQQVAAEY CRACRLKSTC IYGGAPKGPQ IRDLERGVEI CIATPGRLID FLECGKTNLR RTTYLVLDEA DRMLD. It is sometimes possible for the material contained within the vial of "DDX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.