Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199026_WB13.jpg WB (Western Blot) (WB Suggested Anti-DHODH Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateDHODH is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit DHODH Polyclonal Antibody | anti-DHODH antibody

DHODH antibody - C-terminal region

Gene Names
DHODH; URA1; POADS; DHOdehase
Reactivity
Tested Species: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
DHODH, Antibody; DHODH antibody - C-terminal region; UBC; TMED10; MT2A; FKBP8; SSBP1; SDHA; PLP2; OGDH; NDUFS8; HNRNPM; ILF3; CYC1;; anti-DHODH antibody
Ordering
Host
Rabbit
Reactivity
Tested Species: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
Sequence Length
395
Applicable Applications for anti-DHODH antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DHODH
Protein Size (#AA)
395 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DHODH Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateDHODH is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA199026_WB13.jpg WB (Western Blot) (WB Suggested Anti-DHODH Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateDHODH is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(DHODH antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199026_IHC15.jpg IHC (Immunohistochemistry) (DHODH antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-DHODH antibody
This is a rabbit polyclonal antibody against DHODH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
dihydroorotate dehydrogenase (quinone), mitochondrial
NCBI Official Synonym Full Names
dihydroorotate dehydrogenase (quinone)
NCBI Official Symbol
DHODH
NCBI Official Synonym Symbols
URA1; POADS; DHOdehase
NCBI Protein Information
dihydroorotate dehydrogenase (quinone), mitochondrial
UniProt Protein Name
Dihydroorotate dehydrogenase (quinone), mitochondrial
UniProt Gene Name
DHODH
UniProt Synonym Gene Names
DHOdehase
UniProt Entry Name
PYRD_HUMAN

Similar Products

Product Notes

The DHODH dhodh (Catalog #AAA199026) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHODH antibody - C-terminal region reacts with Tested Species: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DHODH can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the DHODH dhodh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGLSGKPLRD LSTQTIREMY ALTQGRVPII GVGGVSSGQD ALEKIRAGAS. It is sometimes possible for the material contained within the vial of "DHODH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.