Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46830_IHC10.jpg IHC (Immunohistochemistry) (DHODH was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit DHODH Polyclonal Antibody | anti-DHODH antibody

Anti-DHODH Antibody

Gene Names
DHODH; URA1; POADS; DHOdehase
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
DHODH, Antibody; Anti-DHODH Antibody; DHOdehase; Dhodh; POADS; URA1; Q02127; Dihydroorotate dehydrogenase (quinone), mitochondrial; anti-DHODH antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
395
Applicable Applications for anti-DHODH antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(DHODH was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46830_IHC10.jpg IHC (Immunohistochemistry) (DHODH was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(DHODH was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46830_IHC11.jpg IHC (Immunohistochemisry) (DHODH was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(DHODH was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46830_IHC13.jpg IHC (Immunohiostchemistry) (DHODH was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of DHODH expression in rat liver extract (lane 1), mouse spleen extract (lane 2) and HEPG2 whole cell lysates (lane 3). DHODH at 43KD was detected using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46830_WB15.jpg WB (Western Blot) (Western blot analysis of DHODH expression in rat liver extract (lane 1), mouse spleen extract (lane 2) and HEPG2 whole cell lysates (lane 3). DHODH at 43KD was detected using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-DHODH antibody
Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection.
Background: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
References
1. Ng, S. B., Buckingham, K. J., Lee, C., Bigham, A. W., Tabor, H. K., Dent, K. M., Huff, C. D., Shannon, P. T., Jabs, E. W., Nickerson, D. A., Shendure, J., Bamshad, M. J. Exome sequencing identifies the cause of a mendelian disorder. Nature Genet. 42: 30-35, 2010.
2. White, R. M., Cech, J., Ratanasirintrawoot, S., Lin, C. Y., Rahl, P. B., Burke, C. J., Langdon, E., Tomlinson, M. L., Mosher, J., Kaufman, C., Chen, F., Long, H. K., Kramer, M., Datta, S., Neuberg, D., Granter, S., Young, R. A., Morrison, S., Wheeler, G. N., Zon, L. I. DHODHmodulates transcriptional elongation in the neural crest and melanoma. Nature 471: 518-522, 2011.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,867 Da
NCBI Official Full Name
dihydroorotate dehydrogenase (quinone), mitochondrial
NCBI Official Synonym Full Names
dihydroorotate dehydrogenase (quinone)
NCBI Official Symbol
DHODH
NCBI Official Synonym Symbols
URA1; POADS; DHOdehase
NCBI Protein Information
dihydroorotate dehydrogenase (quinone), mitochondrial
UniProt Protein Name
Dihydroorotate dehydrogenase (quinone), mitochondrial
UniProt Gene Name
DHODH
UniProt Synonym Gene Names
DHOdehase

Similar Products

Product Notes

The DHODH dhodh (Catalog #AAA46830) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-DHODH Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DHODH can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the DHODH dhodh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DHODH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.