WB (Western Blot)
(Host: RatTarget Name: DIO2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
Rabbit anti-Human DIO2 Polyclonal Antibody | anti-DIO2 antibody
DIO2 Antibody - middle region
Gene Names
DIO2; D2; 5DII; SelY; DIOII; TXDI2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DIO2, Antibody; DIO2 Antibody - middle region; anti-DIO2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: ILLKHVVLLLSRSKSTRGEWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDA
Sequence Length
273
Applicable Applications for anti-DIO2 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DIO2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RatTarget Name: DIO2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RatTarget Name: DIO2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: DIO2Sample Tissue: ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: DIO2Sample Tissue: ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DIO2 antibody
The protein encoded by this gene belongs to the iodothyronine deiodinase family. It activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). It is highly expressed in the thyroid, and may contribute significantly to the relative increase in thyroidal T3 production in patients with Graves disease and thyroid adenomas. This protein contains selenocysteine (Sec) residues encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-DIO2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
type II iodothyronine deiodinase isoform a
NCBI Official Synonym Full Names
iodothyronine deiodinase 2
NCBI Official Symbol
DIO2
NCBI Official Synonym Symbols
D2; 5DII; SelY; DIOII; TXDI2
NCBI Protein Information
type II iodothyronine deiodinase
UniProt Protein Name
Type II iodothyronine deiodinase
UniProt Gene Name
DIO2
UniProt Synonym Gene Names
ITDI2; TXDI2
Similar Products
Product Notes
The DIO2 dio2 (Catalog #AAA201566) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DIO2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DIO2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DIO2 dio2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILLKHVVLLL SRSKSTRGEW RRMLTSEGLR CVWKSFLLDA YKQVKLGEDA. It is sometimes possible for the material contained within the vial of "DIO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.